SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021242 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021242
Domain Number 1 Region: 339-444
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.54e-22
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0015
Further Details:      
 
Domain Number 2 Region: 78-141
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000811
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 
Domain Number 3 Region: 160-214,242-256
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000684
Family N-terminal PAS domain of Pas kinase 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021242   Gene: ENSOARG00000019779   Transcript: ENSOART00000021537
Sequence length 608
Comment pep:known_by_projection chromosome:Oar_v3.1:3:187229979:187326072:-1 gene:ENSOARG00000019779 transcript:ENSOART00000021537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGNQCIASSHLSPWTQPIATGSFSPRVTELPRKRRQSDSDPSQSGIMKEKVVEKLSQNP
FTCLLSTRVEMSAFSCSREAHSQTEKRRRDKMNNLIGKLSTMIPQCSPMARKLDKLTVLR
MAVQHLRSLKGMTSSYPGNNYRPSFIHDNELRHLILKTAEGFLFVVGCERGKILFVSKSV
SKILNYDQASLIGQSLFDFLHPKDVSKVKEQLSSSDISPREKLRDAKAALQVHSNFHTSK
SHVYSGSRRSFFCRIKSCKISVKEEHEYLPNSKKKDHRKFCTIHCTGYLRSWPPNIAGME
EERDNKKDRSDFTCLVAIGRLRPHIVPQNSSEIKVKPAEFITRFAVNGKFVYVDQSFKTR
ATAILGYLPQELLGTSCYEYFHQDDHSNLTDKHKAVLQSKEKIFTDSYKFRAKDGSFVTL
KSQWFSFTNPWTKELEYIVSVNTVVLGHSDAGETSLLPCSSQSSEGSSRQSLISVPGTST
EILLGAGSIGTEVASEFLDLQRLQSSSSLDSSPADLLKDTHTLNCRNMSDKELITLSPSE
IGEQEATKQNQSAIAPLSHEPLLGEGVQLDFEALCDNDDTAMAAFMNYLEAEGGLGDPGD
FSDIHWTL
Download sequence
Identical sequences W5QEU4
ENSOARP00000021242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]