SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021256 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021256
Domain Number 1 Region: 10-165
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 2.75e-83
Family Hedgehog (development protein), N-terminal signaling domain 0.000000076
Further Details:      
 
Domain Number 2 Region: 170-316
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.14e-40
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021256   Gene: ENSOARG00000019793   Transcript: ENSOART00000021552
Sequence length 378
Comment pep:known_by_projection chromosome:Oar_v3.1:2:219983551:219988708:-1 gene:ENSOARG00000019793 transcript:ENSOART00000021552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGGRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKD
EENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDI
TTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGGCFPAGAQVRLE
SGARVALSAVRPGDRVLAMGEDGNPTFSDVLIFLDREPDRLRAFQVIETQDPPRRLALTP
AHLLFTANNHTEPAAHFRATFASQVQPGQYVLVAGVPGLQPARVAAVSTHVALGAYAPLT
RHGTLVVEDVVASCFAAVADHHLAQLAFWPLRLFHSLAWGSWTPGEGVHWYPQLLYRLGR
LLLEEGSFHSLGVAGAGS
Download sequence
Identical sequences W5QEV8
ENSOARP00000021256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]