SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021484 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021484
Domain Number 1 Region: 9-90
Classification Level Classification E-value
Superfamily dUTPase-like 2.22e-20
Family dUTPase-like 0.00072
Further Details:      
 
Domain Number 2 Region: 99-140
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000704
Family Retroviral protease (retropepsin) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021484   Gene: ENSOARG00000020008   Transcript: ENSOART00000021784
Sequence length 143
Comment pep:novel chromosome:Oar_v3.1:8:50458092:50458520:1 gene:ENSOARG00000020008 transcript:ENSOART00000021784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVYKLRTVFGPLPRGTFGLILGRSSAALRGLIVLSGVIDSDYVGEILIMVSTSQTLSLLA
GERIAQLLLLPYHLFPSYSNERVGGFGSTGQSIFWEMLINDSHPLMSLIIEDRQFEGLVD
TGADVSVISLQQWPNDWKKKIPP
Download sequence
Identical sequences W5QFI6
ENSOARP00000021484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]