SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021485 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021485
Domain Number 1 Region: 2214-2406,2461-2644,2680-2735
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.22e-109
Family DNA polymerase I 0.00000104
Further Details:      
 
Domain Number 2 Region: 244-412,445-500,556-644
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.99e-43
Family Tandem AAA-ATPase domain 0.00037
Further Details:      
 
Domain Number 3 Region: 808-982
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 2.56e-42
Family Achaeal helicase C-terminal domain 0.0015
Further Details:      
 
Domain Number 4 Region: 2045-2179
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000375
Family DnaQ-like 3'-5' exonuclease 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000021485
Domain Number - Region: 681-764
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.049
Family RecQ helicase DNA-binding domain-like 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021485   Gene: ENSOARG00000020009   Transcript: ENSOART00000021785
Sequence length 2739
Comment pep:known_by_projection chromosome:Oar_v3.1:1:184232538:184335029:-1 gene:ENSOARG00000020009 transcript:ENSOART00000021785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSRYQLKSRARLILLCQKVKHRSINKLLVPNDHSGTSRAPSMQRSAINSLCPTIIHQNTN
MLNRTTSLIYLLWSLWSSGYSRHWELYGPGAGWEACVLKPWREDGGRVRRQGQFFPSGRT
LGLCVSLNGGEGFAMNITRWSGKQRRSASGLDSSSGSGFDGSDNPLLLSGPVLSPPPGLG
RSLKDRGRRPAGATEGECKQTFPDDQIDKLLLANWGLPTAVLEKYHSFGVKKMFEWQAEC
LLLGQVLEGKNLVYSAPTSAGKTLVAELLILKRVLEMRKKALFILPFVSVAKEKKYYLQS
LFQEVGIKVDGYMGSTSPTRHFSSLDIAVCTIERANGLINRLIEENKMDLLGMVVVDELH
MLGDSHRGYLLELLLTKICYITQKSASCQADLAIPLSNAIQIVGMSATLPNLELVASWLN
AELYHTDFRPVPLLESIKIGNSIYDSSMKLVREFQPTLQVKGDEDHVVSLCYETIRDNHS
VLLFCPSKKWCEKLADIIAREFYSLHHQAEGNFFVTGLVRSSEFPPVMLEQKGLLEVMDQ
LKRSPSGLDSVLQKTVPWGVAFHHAGLTFEERDIIEGAFRQGQIRVLAATSTLSSGVNLP
ARRVIIRTPIFSGRLLDILTYKQMVGRAGRKGVDTVGESILVCKNSEKSQGITLLQGSLK
PVRSCLQRQEGEEVLQKISNFFSQIIVGGVASTSQDIQTYASCTFLAASMKEGKQGIQKN
KDSVQLGAIEACVMWLLENEFIQMTEASDGTEGNVYHPTHLGSATLSSSLSPVDTLDIFA
DLQRAMKGFVLENDLHIVYLVTPVFEDWTTIDWYRFFCLWEKLPASMKRVAELVGVEEGF
LARCVKGNLVARTERQHRQMAIHKRFFTSLVLLDLISEVPLKEINQKYGCNRGQIQSLQQ
SAAVYAGMVTVFSNRLGWHNMELLLSQFQKRLTFGIQRELCDLVRVSLLNAQRARFLYAS
GFLTVADLARADVAEVESVLKNAAPFKSTRKAVDEEEEAVEERRNMRTIWVTGRRGLSER
EAATLIVEEARMILQQDLVEMGVQWNLHSFLNSDTHSLTSSESEVKEHKFIPQTKSSYKR
LTSKKKSDTIFSDSVNHLPDTMQDLDKNREHTDSFYYKFQDGHQECHHSISRAKKQASLS
IKKGKLGTSLNEGKVSTLKVVRTLSSGKTKREALSFSSEKVSTVSQSWKRGKHRKRSRHS
SPVKDTKMRRINLQERTMSTSIHCEDSFTLDETSMEFRSPEPFAKNVSFCAERRYNIIPF
ASQTEQSCSRNSKIPNDVLGEHFITGSQSKHVIQATSVVSENGRELAVESEKKNKVVIQN
DSKIQNVYVKQHDTHPINQCLEKQFNKKTNTHTKLNTAVAKQIPFETDSSYINRDSNVIM
KCESIKFNAEENKSSNLKVPGDIISSTEIPSEVHLRSGALGKLGGQPENILNTPRVQGKT
DAYAADKTKNNHVSDLVLDLCDLEDSFYLDTQSEKIIQQIATENANQEGPKDTSLATGMI
QKNLDKQSSMSSFQKETHVAFPGEQHSLEMTNHLKHKTVDVVKQSTDSHEVDTLTPERPV
FYSPILVGENGPCFKGSELSVTDSQLNSFLQGYQTQEAMKPVIPVVPQKRTPADREVECL
PVPETSLNLSGSLLFDSFSEDYLVKEQQHDGQEKEHLLSEITSVHFNDSLCLQPEGIIKK
PDMNDNQDNQQPLSCFSDESIIFSEIDSVQMVAALDNVDIVPVQEKHNTAESLKILKLSD
PVTVGNDYSQREVIGGDKDKRSQKSKLSGTRQDNSFLWSGASFDLSPGLQRILDQVSSPL
ENEKPKLTATDLPGLNGENAEVNDRQEVISNTEPNQVQGIPFSPKIVIRGNIEALQNDVI
HGETSLLPCKENCIVQDNGLIPPTPIPSDSKLAFPDILGTSVKLKKISNGFKLGESSSFG
SPSNNKNHDLHPESRNGFKDNSSIRDTSFSPQLLQNGSQLTLASCSPESLAIIDVASDQT
LFQTFMKEWQSKTRFSISLACEKIRNLTSSKSATIGGMFKQVSFPQEASIRDDGFPVKDC
DDILVVGLAVCWGGKDAYYFSLQKEQKHSEISASLIPPSLDPSLTVKDRLWHLQSCFQKE
SDKERSVIIYDFIQSYKILLLSCGISLEQSYEDPKVACWLLDPDSKEPTLHSIVSRFLPH
ELPLLEEIETGQGIQSLGLNVSTEHSGRYRASVESILIFNSMNQLNSLLKKENLQDVFCK
VEMPSQYCLALLELNGIGFSTAECDSQKHIMQAKLDAIEMQAYQLAGHSFSFTSSDDIAE
VLFLELKLPPNGEGKNQGIKKTLGSTRRGNDNGRKLRLAKQFSTSKDVLNKLRALHPLPG
LILEWRRITNAITKVVFPLQREKRLNPFLGMERIYPVSQSHTATGRITFIEPNIQNVPRD
FEIKMPTAVEESPPSQALGKGLLPMGSNRGGKKKGCGMNTERQTKMEERASDRGMPFSVS
MRHAFVPFTGGLILAADYSQLELRILAHLSHDHRLIQVLNTGTDVFRSIAAEWKMIEPES
VGDNLRQQAKQICYGIIYGMGAKSLGEQMGIKENDAACYIDSFKSRYTGISHFMRETVKN
CKRDGFVQTILGRRRYLPGIKDNNPYHKAHAERQAINTRVQGSAADIVKIATVNIQKQLE
TFHSTFKSHGHRESLLQSDRTGLGWLPKKKLQGMFCPIRGGFFILQLHDELLYEVAEEDV
VQVAQIVKNEMESAIKLSVKLRVKVKIGASWGELKDFDV
Download sequence
Identical sequences W5QFI7
ENSOARP00000021485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]