SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021772 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021772
Domain Number 1 Region: 5-77
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.79e-22
Family Chaperone J-domain 0.00044
Further Details:      
 
Domain Number 2 Region: 190-269
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000774
Family Canonical RBD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021772   Gene: ENSOARG00000020273   Transcript: ENSOART00000022076
Sequence length 304
Comment pep:known_by_projection chromosome:Oar_v3.1:7:33334255:33364304:-1 gene:ENSOARG00000020273 transcript:ENSOART00000022076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVTKELLQMDLYALLGIEEKAEDKEVKKAYRQKALSCHPDKNPDNPRAAELFHQLSQAL
EVLTDAAARAAYDKVRKARKQAAERTQKLDERRKKVKLDLEARERQAQALGSEEEEESGN
ARTLEQEIERLREEGSRQLEEQQRLIREQIRQEQEQRLRGMAENPESKETPKLKLKWKSK
KEAESQGGYSRDVLLRLFQKYGEVLDLVLSSKKAGTAVVEFATVKAAELAVQNEVGLVDN
PLKISWLEGRPQSAMGHNHPGLSRGSVVSERDYESLVMMRMRQAAERQQLIAQMQQEDQA
GQPT
Download sequence
Identical sequences W5QGC3
ENSOARP00000021772 XP_004010498.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]