SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021828 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021828
Domain Number 1 Region: 24-185,480-687
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 8.24e-72
Family Quinoprotein alcohol dehydrogenase-like 0.03
Further Details:      
 
Domain Number 2 Region: 280-313,352-527
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.56e-26
Family WD40-repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021828   Gene: ENSOARG00000020325   Transcript: ENSOART00000022132
Sequence length 945
Comment pep:known_by_projection chromosome:Oar_v3.1:1:94508443:94541906:1 gene:ENSOARG00000020325 transcript:ENSOART00000022132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLTKQYLRYVASAVFGLIGSQKGNIVFVTLRGEKGRYVAVPACEHVFIWDLRKGEKILI
LQGLKHEVTCLCPSPDGLHLAVGYEDGSVRIFSLLSGEGNVTFNGHKAAITSLKYDQLGG
RLASGSKDTDVIVWDVINESGLYRLKGHKDAITQALFLREKNLLVTSGKDTMVKWWDLDT
QHCFKTMVGHRTEVWGLVLVSEEKRLITGASDSELRAWDISYLQEKQIEDPEEPEPKKIK
ESSPGIQDSHEAEDGTLEMDEAPEDRILTCRKAGSIMREGRDRVVNLAVDRTGRILACHG
TDSVLEVFCILSKEEIQKKMDKKMKKAKKRAKLNSCNEEEEDLEVNVKMTLQDEIQRVAN
IKTSAKIKSFDLIHTPQGELKAVFLLQNNLVELYSLNASTTGPQPIRTNRITIGGHRSDV
RTLSFSSDNIAILSAAADSIKIWNRSTLQCIRTMTCEYALCSFFVPGDRQVVIGTKTGKL
QLYDLASGNLLETIDAHDGALWSLSLSPDQRGFVTGGADKSVKFWDFELVKDENSTQKRL
SVKQTRTLQLDEEVLCVSYSPNQKLLAVSLLDCTVKIFYVDTLKFFLSLYGHKLPVICMD
ISYDGALIATGSADRNVKIWGLDFGDCHKSLFAHDDSVMFLRFVPKSHLFFTAGKDRKIK
QWDADKFEHIQTLEGHHQEIWCLAVSPSGDYVVSSSHDKSLRLWERTREPLILEEEKEMQ
REAEYEESVAKEDQPAVPGETQGDSYFTGKKTIETVKAAERIMEAIELYREETAKMREHK
AICKAAGKEVPLPINPILMAYGNISPSAYVLEIFKGIKSSELEESLLVLPFAYVPDILRL
FNEFIQQGSDIELLCRCLFFLLRIHFGQITSNQMLVPVIEKLKETTISKVRQVRDVIGFN
MAGLDYLKRECEAKSEVMFFADATSHLEEKKRKRKKREKLILTVT
Download sequence
Identical sequences W5QGH9
ENSOARP00000021828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]