SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021934 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021934
Domain Number 1 Region: 99-149
Classification Level Classification E-value
Superfamily Orange domain-like 1.83e-16
Family Hairy Orange domain 0.0022
Further Details:      
 
Domain Number 2 Region: 25-94
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000209
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021934   Gene: ENSOARG00000020422   Transcript: ENSOART00000022239
Sequence length 248
Comment pep:known_by_projection chromosome:Oar_v3.1:1:191624405:191627209:-1 gene:ENSOARG00000020422 transcript:ENSOART00000022239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNE
VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPQFAFLIPNG
AFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSIISSFWEVYLRKYNKISVLGSNR
ESMWRPSW
Download sequence
Identical sequences W5QGT5
ENSOARP00000021934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]