SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000022087 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOARP00000022087
Domain Number - Region: 169-287
Classification Level Classification E-value
Superfamily TrmE connector domain 0.0863
Family TrmE connector domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000022087   Gene: ENSOARG00000020554   Transcript: ENSOART00000022392
Sequence length 291
Comment pep:known_by_projection chromosome:Oar_v3.1:2:228596170:228619345:1 gene:ENSOARG00000020554 transcript:ENSOART00000022392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNADLEQGFQEGVSNASVIMQVPERIVVA
GNNEDIPFSRPADLDLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPAPTPQNEEIRA
VGRLKRERSMSENAVRQNGQLVKTDSIVTPSPPQVRVCPPRMLPEDGANLSSARGILSLI
QSSTRRAYQQILDVLDENRRPVLRGGSAAATSNPHHDNVRYGISNIDAMIEGTSEDMTVV
DAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLWFRR
Download sequence
Identical sequences W5QH87
ENSOARP00000022087 XP_005202967.1.76553 XP_005890199.1.15283 XP_010828222.1.44457 XP_010835346.1.44457 XP_012013477.1.54773 XP_014949055.1.66739 XP_017914316.1.57651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]