SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000022360 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000022360
Domain Number 1 Region: 318-423,546-662
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.53e-56
Family Phosphate binding protein-like 0.0000000406
Further Details:      
 
Domain Number 2 Region: 3-243
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.02e-21
Family L-arabinose binding protein-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000022360   Gene: ENSOARG00000020802   Transcript: ENSOART00000022665
Sequence length 1293
Comment pep:known_by_projection chromosome:Oar_v3.1:3:200958970:201197462:1 gene:ENSOARG00000020802 transcript:ENSOART00000022665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTIENSFVGW
ELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYIFEVANSVGLTGYGYTWI
VPSLVAGDTDTVPSEFPTGLVSVSYDEWDYGLPARVRDGIAIITTAASDMLSEHSFIPEP
KSSCYNTHEKRIYQSNMLNRYLINVTFEGRNLSFSEDGYQMHPKLVIILLNKERKWERVG
KWKDKSLQMKYYVWPRMCPETEEQEDDHLSIVTLEEAPFVIVESVDPLSGTCMRNTVPCQ
KRIISENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYLVTNGKHGKKINGTWNGM
IGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSAD
VWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGRAEPGGPSFTIGKAIWLLWGLVFNN
SVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKKFQRPND
FSPPFRFGTVPNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLSLKTGKLDAFIYDAAVL
NYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAILQLFGDGEMEELEALW
LTGICHNEKNEVMSSQLDIDNMAGVFYMLGAAMALSLITFICEHLFYWQFRHCFMGVCSG
KPGMVFSISRGIYSCIHGVAIEERQSVMNSPTATMNNTHSNILRLLRTAKNMANLSGVNG
SPQSALDFIRRESSVYDISEHRRSFTHSDCKSYNNPPCEENLFSDYISEVERTFGNLQLK
DSNVYQDHYHHHHRPHSIGSASSIDGLYDCDNPPFTTQPRALGKKPLDIGLPSSKHSQLG
DLYGKFSFKSDRYGGHDDLIRSDVSDISTHTVTYGNIEGNAAKRRKQQYKDSLKKRPASA
KSRREFDEIELASRRRPPRSPDHKRYFRDKDGLRDFYLDQFRAKETSPHWEHVDLTDLYK
ERGEDFKRDSVGGGGPCTNRAHHLKHGTGDKHGGGVVGGGPAPREETQTNVGWDAGAPVG
AVTSAASKYPQSPTNSKAQKKPRNKLRRQHSYDTFVDLQKEEAALAPRSVSLKDKGRFLD
GSPYAHMFEMPAGESAFSGRAAPPPAGHPPHGNPGGGGGYMLSKSLYPDRVTQNPFIPTF
GDDQCLLHGSKSYFFRQPTVAGAPKARPDFRALVSNKPVVSALHGAVPGRFQKDICIGNQ
SNPCVPNNKNPRAFNGSSNGHVYEKLSSIESDV
Download sequence
Identical sequences W5QI10
ENSOARP00000022360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]