SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000022500 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000022500
Domain Number 1 Region: 41-85
Classification Level Classification E-value
Superfamily LysM domain 0.0000000445
Family LysM domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000022500   Gene: ENSOARG00000020938   Transcript: ENSOART00000022810
Sequence length 225
Comment pep:known_by_projection chromosome:Oar_v3.1:1:99969485:99975622:-1 gene:ENSOARG00000020938 transcript:ENSOART00000022810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSRQAPLGGSGLLQGSRARSYGSLVQSACSPVRERRLEHQLAPGDTLAGLALKYGVT
MEQIKRANRLYTNDSIFLKKTLYIPILTEPRDLFNGLDSEEEKDGEEAVQPSKDEVRPHS
AERKKRERGLGHPNGEVLPTPGQEPPMHDLSASDFLKKLDSQISLSKKAAAQKLKKGESG
IPGEDSSLHLSSPRMQQRAVLGPVPLTQTSRTRTLRDQEDEIFKL
Download sequence
Identical sequences W5QIE8
XP_004002528.1.66739 XP_005970740.1.78601 XP_012026548.1.54773 ENSOARP00000022500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]