SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000022516 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000022516
Domain Number 1 Region: 9-162
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 4.08e-21
Family Bcl-2 inhibitors of programmed cell death 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000022516   Gene: ENSOARG00000020952   Transcript: ENSOART00000022826
Sequence length 193
Comment pep:known_by_projection chromosome:Oar_v3.1:7:55217957:55220477:1 gene:ENSOARG00000020952 transcript:ENSOART00000022826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRPPGRGGAMVDPFRERTARLLMDWLEFCAREPGTPAPAPSTPEAAVLRHVAARVLEANR
NVLPLYRRYRRHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERQPQTTRRQKRD
DGSVSRDCRLLVALLCAQFCERHRAWLMANGGWDGFCLSFSHSLQPSWERQLVWFFLSYW
TAIIIIYFWIKLS
Download sequence
Identical sequences W5QIG4
ENSOARP00000022516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]