SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000022528 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000022528
Domain Number 1 Region: 72-117
Classification Level Classification E-value
Superfamily LysM domain 0.0000000654
Family LysM domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000022528   Gene: ENSOARG00000020963   Transcript: ENSOART00000022838
Sequence length 215
Comment pep:known_by_projection chromosome:Oar_v3.1:7:55635069:55647474:1 gene:ENSOARG00000020963 transcript:ENSOART00000022838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSSPAPSLRAGGPRAPRPSAPSPPPPHLRSGSEAEEAEQSLSLARTKTRSYGSTGSVR
APLGAGVIERHVEHRVRAGDTLQGIAPSHGVAMEQIKRTNKLFTNDCIFLKKTLNIPVIS
EKPLLFNGLNSVDSPENETVDSFSHEEELVGSGEDVSPPSPQELDVQPMQPEEVSARDFL
QRLDLQIKLSTQAAKKLKEESRDEESLYTASLYHS
Download sequence
Identical sequences W5QIH6
ENSOARP00000022528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]