SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000022556 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000022556
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.4e-25
Family Cyclophilin (peptidylprolyl isomerase) 0.0000424
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000022556   Gene: ENSOARG00000020989   Transcript: ENSOART00000022867
Sequence length 104
Comment pep:novel chromosome:Oar_v3.1:7:56889187:56889919:1 gene:ENSOARG00000020989 transcript:ENSOART00000022867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCQGGDFTHYNGTHGKSICGERYDEESLIPKHMGPSILSMAKAGSDTICSQFFICTVKTE
CLNGKPVVFGKVKGHEYRGSHGVLWSRNGRTTKKLFNADCGQLD
Download sequence
Identical sequences W5QIK4
ENSOARP00000022556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]