SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000022718 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000022718
Domain Number 1 Region: 260-361
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.38e-29
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000112
Further Details:      
 
Domain Number 2 Region: 114-221
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.06e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.027
Further Details:      
 
Domain Number 3 Region: 33-89
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000096
Family HLH, helix-loop-helix DNA-binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000022718   Gene: ENSOARG00000021136   Transcript: ENSOART00000023031
Sequence length 841
Comment pep:known_by_projection chromosome:Oar_v3.1:7:70782330:70807563:1 gene:ENSOARG00000021136 transcript:ENSOART00000023031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRSLEGEEIYLKKQLRPEPGERVRKPKLNRISSERRKEKSRDAARSRRSKESEVFYELAH
QLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGDLDIEDEMKAQMNCFYLKALDGFVMV
LTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQN
TQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQSQCGYKKPPMTCLVL
ICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHAL
DSDHLTKTHHDMFTKGQVTTGQYRMLAKRGGYVWIETQATVIYNTKNSQPQCIVCVNYVV
SGIIQHDLIFSLQQTECVLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAP
AAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSSNEKLQNINLAMSPLPASETPKPL
RSSADPALNQEVALKLEPNPESLELSFTMPQIQDQPASPSDGSTRQSSPEPNSPSEYCFD
VDSDMVNEFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSP
LENSSTSPQSASTNTVFQPTQMQEPPIATATTTATNDELKTVTKDGTEDIKILIAFPSPP
HVPKEPPCATTSPYSDTGSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTAPEEE
LNPKILALQNAQRKRKIEHDGSLFQAVGIGTLLQQPDDRATTTSLSWKRVKGCKSSEQNG
MEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQV
N
Download sequence
Identical sequences W5QJ16
ENSOARP00000022718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]