SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000022752 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000022752
Domain Number 1 Region: 187-303
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 2.35e-42
Family eIF-2-alpha, C-terminal domain 0.000000614
Further Details:      
 
Domain Number 2 Region: 90-183
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 1.31e-33
Family eIF2alpha middle domain-like 0.00000188
Further Details:      
 
Domain Number 3 Region: 11-93
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.43e-17
Family Cold shock DNA-binding domain-like 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000022752   Gene: ENSOARG00000021166   Transcript: ENSOART00000023065
Sequence length 315
Comment pep:known_by_projection chromosome:Oar_v3.1:7:76140063:76155742:1 gene:ENSOARG00000021166 transcript:ENSOART00000023065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTETMPIKINLIAPPRYVMTTT
TLERTEGLSVLNQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQLERLERENAEV
DGDDDAEEMEAKADD
Download sequence
Identical sequences W5QJ50
XP_004010780.1.66739 XP_004010781.1.66739 ENSOARP00000022752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]