SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000022815 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000022815
Domain Number 1 Region: 59-116
Classification Level Classification E-value
Superfamily Kringle-like 1.91e-17
Family Fibronectin type II module 0.0037
Further Details:      
 
Domain Number 2 Region: 28-70
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000114
Family Fibronectin type II module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000022815   Gene: ENSOARG00000025189   Transcript: ENSOART00000027091
Sequence length 118
Comment pep:known scaffold:Oar_v3.1:AMGL01120400.1:1113:3739:1 gene:ENSOARG00000025189 transcript:ENSOART00000027091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEPPPAVYNVLGMLTTTWSYTTADQGPPCAFPFTYKRRIYYKCTSVNSEREWCSLDEDYV
GRWKICSKRDRPKCHFPFIYRDKRYFRCTTEGSAFGLAWCSLTEYFEREYAWQYCDRY
Download sequence
Identical sequences W5QJB1
ENSOARP00000022815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]