SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000572 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000572
Domain Number 1 Region: 431-819
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.27e-130
Family Ankyrin repeat 0.000000000332
Further Details:      
 
Domain Number 2 Region: 187-449
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.48e-73
Family Ankyrin repeat 0.000003
Further Details:      
 
Domain Number 3 Region: 34-256
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.8e-54
Family Ankyrin repeat 0.0000172
Further Details:      
 
Domain Number 4 Region: 3529-3623
Classification Level Classification E-value
Superfamily DEATH domain 5.38e-25
Family DEATH domain, DD 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000572   Gene: ENSOARG00000000537   Transcript: ENSOART00000000602
Sequence length 3920
Comment pep:known_by_projection chromosome:Oar_v3.1:6:12367611:12719843:-1 gene:ENSOARG00000000537 transcript:ENSOART00000000602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEDAAQKSDSGEKFNGSSQRRKKPKKSDSNASFLRAARAGNLDKVVEYLKGGIDINTCN
QNGLNALHLAAKEGHVGLVQELLGRGSAVDSATKKGNTALHIASLAGQAEVVKVLVKEGA
NINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAI
LLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAA
HYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLT
PLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDV
TLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYG
ASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVR
CLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREG
QVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLH
VAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLSYGAETNIVTKQ
GVTPLHLASQEGHTDMVTLLLDKGANIHMATKSGLTSLHLAAQEDKVNVADVLTKHGVDQ
DAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLL
QHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTE
VLDVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRS
FSSDRSHTLSHASYLRDSAMIDDTVVIPSHQVTTLAKEAERNSYRLSWGTENLDNVALSS
SPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMV
EGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHYCEYTE
EELNEILNGMDEVLDTPEDLEKKRVCRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSST
VVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPIT
MTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTN
VSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKV
DKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLF
VKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTSE
KNDETESTETSVLKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTAILTTDGSDRAGSIKV
KELVKAAEEEPGEPFEIVERVKEDLEKVNEILRSGTCTGDEGSVPRSQPEKELEEEEWVI
VSEEEIEEAKQKASSEITEYPCVEVRLDKETKAEVEKDSTGLVNYLTEDLNSYVPPHEEQ
PQKERGMVGEKREAQGPSRRSESEGKDAPSEETQSTQKQPKPSLGIKKPVRRKLKEKQKQ
KEDSSQAGAEKTDLKKGSSEESLDEDTGSAPEPLPAVKATSPLIEETPIGSIKDKVKALQ
KRVEDEQKGRSKLPVRVKGKEDVPKKITQRTHLAASPSLKSERHAPASASSRTERHTSLS
SSAKTERHPPVSPSSKNEKHSPVSPSAKTERHSPVSSASKTEKHSPVSPSTKTERHSPVS
SSAKTERHPPVSPSGKTDKRPPGSPSGRTEKHPPVSPGRTEKRLPVSPAGRMEKHSPAPS
SGKTEKHLPLSPSGKTDKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEH
KSTKQKQPQEKGRGRLEKERGPIVTPREVPKTESQTIKRGQRFLVTGLSEPRRAVRASST
GLKREDGAGEKEKSPNHKTPEPVQPVPEEESHKDSEVPKEKLADDQGDMDLQISPDRKTS
TDFSDVIKQELEDNDKYQQFRMTEEPEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSL
QSGALPGSSESLKPEGVADSPCGSLMEGTPQISSEESYKHEGLAETPETSPESLSFSPKK
SEEQIGETHETTKLETALESHSEKGHPSTKDVADGSEGQGAAVTEAAESSAECQLTEATP
DPSKDMCPPQEGDSLGGQSVSLAKQTPEGPTEEATCDEGPVAHISPPHEPQTDTEAQEST
ATKPSEEAEASPLSEAAVKAGSGTESKPQAAIRSPQGLELALPSRESEVFSPGADESFAV
SHKDSLEASPVLEDNSSHKTPDSLEPSPLKESPCRDSLESSPVEPKMKAGILPSHFPLPS
AVAKTELFTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVT
PKTTDTPKPAVIPECAEEDDSENGEKKRFTPEEEMFKMVTKVKTFDELEQEAKQKRDYKR
EPKQEESSSSSDADVDCSADTDEPKHTGSVEDESDAPAVVTTEGRKASSSSESEPELTQL
KKGADSGLLAEPVIRVQPPSPLPSSIDSNSSPEEIQFQPIVSKQYTFKMNEDAQEDSDKS
EEEKDDKSRLPEDSHALPTDGPEISYDDLNGDTYQPKLCDSLGCEIGSHTNSAAPVSSGL
HSSPGDDVSEQLVIHKESLALQDTSEKDLEEELDVPGVESPQADPPSESSPSFSSLPLCP
ASEAKELDEGMVSTASATEMEVTKTDQAFESLPEDCSIQDSLITTQTDRSSLDVPVSDPI
ETDEIYEPQVISPYENVPSQSFFSGEESKTQTDTRHASFHSSEEYSVTITSSVEDVVETS
SSDKTVSSKEANFEDQVLEVESKQESTLQEVQSDGASSSLETTVPKTSTVVSEQISKVII
TKTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPT
SEQNPFLFQEGKLFEMTRSGAIDMTKRSYADESFHFFQIGQESREETLSQDMKEGGTGAE
APQVETSAESLTLSESKETVDDEAELLPDDLSEGVEEIHTSDTPLSSQIDISASIETSMK
EATSTGLEDLPTRQMGDSLPLSSVKQTTCPDFPGQVVQVQLDFSTVTRSVYSDRGDDSPD
SSPEEQKSVIEIPTAPMENVPSTESKSKIPVRTIPTSTSIPPSAEYESSLYEDFLPGLDE
ESKEDEAKPKSKIPVKAPVQRVEQQPSHLDSPLKKTDGPQGQDLTSSAPDDRSKSESDAS
LGMKTKCPIEIRSYIETETESTGEEEELELESEEGATRPKIFASRLPVKSKSTTSSCRGP
TSPTKDNKEHFFDLYRNSIEFFEEISDEASKLVDRLTQSEREQDLVSDDESSSALEVSVI
ENLPPVETENSIPEDIFDTRPIWDESIETLIERIPDENGHDRAEDQQDEQERIEERLAYI
ADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTSLIEC
LTKINRMDIVHLMETSTESLQERIGHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEE
HAASKEDEVSDHPPIVSEEDISVGYSTFQDGIPKTEGDGSATELLPQTQKEQVQQDFSGK
MQDLPEESSLEQQEYFVTTPGTEMSETQKATGTSGSPTKTPEEIVTPPEEERLYLQTPTS
SERGGSPVVQEPEEPPESREASSPRKTSLVIVESAEDQPQAFEKLDEDAAFQKGDDMPDI
PPETVTEEEYINEHGHTVVKKVTRKIIRRFISSDGTEKEEITMQGTPQDSVSVEEGDGYS
KVIKRIVLKSDTEQSELHID
Download sequence
Identical sequences W5NQY2
ENSOARP00000000572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]