SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002472 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002472
Domain Number 1 Region: 111-598
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.73e-128
Family Pyridoxal-dependent decarboxylase 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002472   Gene: ENSOARG00000002329   Transcript: ENSOART00000002524
Sequence length 599
Comment pep:known_by_projection chromosome:Oar_v3.1:2:137712233:137748395:-1 gene:ENSOARG00000002329 transcript:ENSOART00000002524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSTPSSSATSSNAGVDPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSDKDGRFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARFKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNESYRGKIIPADLETKILEAKQKGYVPLYVNATAGTTVYGAFDPIQE
IADICEKYNLWLHVDAAWGGGLLMSQKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILV
KEKGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKKQGTVGF
ENQVNKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGVPDSPERREKLH
RKVAPKIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
Download sequence
Identical sequences W5NWC5
ENSOARP00000002472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]