SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002929 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002929
Domain Number 1 Region: 178-321
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-41
Family Third domain of FERM 0.000000371
Further Details:      
 
Domain Number 2 Region: 68-177
Classification Level Classification E-value
Superfamily Second domain of FERM 4.71e-38
Family Second domain of FERM 0.000000735
Further Details:      
 
Domain Number 3 Region: 471-553
Classification Level Classification E-value
Superfamily Moesin tail domain 1.23e-24
Family Moesin tail domain 0.0000487
Further Details:      
 
Domain Number 4 Region: 9-66
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-16
Family First domain of FERM 0.0000651
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002929   Gene: ENSOARG00000002759   Transcript: ENSOART00000002988
Sequence length 553
Comment pep:novel scaffold:Oar_v3.1:AMGL01127303.1:63:2980:-1 gene:ENSOARG00000002759 transcript:ENSOART00000002988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVPTPIPFLQVVKTIGLREVWYFGLQYVDNKGFPTWLKLDKKVSAQEVRKESPLQFKFR
AKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEL
HKAGYLGSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDSAMLEYLKIAQDLEMY
GINYFEIKNGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKK
APDFVFYAPRLRINKRILQLCMGNHELYMRGRKPDTIEVQQMKAQAREEKHQKQLERQQL
ETEKKRGETVEREKEQMMREKEELMLRLQDYEEKTRKAEKELSDQIQRALKLEEERKRAQ
EEAGRLEADRLAALRAKEELERQAADQIKSQEQLATELAEYTAKIALLEEARRRKENEVE
EWQLRAKEAQDDLVKTREELHLVMTAPPPPPVYEPVNYHVHEGRQEEGTELSAELSSEGI
LDDRNEEKRITEAEKNERVQRQLMTDQARDENERTHNDIIHNENMRQGRDKNKTLRQIRQ
GNTKQRIDEFEAM
Download sequence
Identical sequences W5NXN2
ENSOARP00000002929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]