SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004750 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004750
Domain Number 1 Region: 167-312
Classification Level Classification E-value
Superfamily PH domain-like 1.88e-45
Family Third domain of FERM 0.00000026
Further Details:      
 
Domain Number 2 Region: 57-166
Classification Level Classification E-value
Superfamily Second domain of FERM 4.71e-38
Family Second domain of FERM 0.000000735
Further Details:      
 
Domain Number 3 Region: 464-551
Classification Level Classification E-value
Superfamily Moesin tail domain 2.88e-30
Family Moesin tail domain 0.000028
Further Details:      
 
Domain Number 4 Region: 3-55
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000579
Family First domain of FERM 0.0000795
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004750   Gene: ENSOARG00000004438   Transcript: ENSOART00000004831
Sequence length 551
Comment pep:novel chromosome:Oar_v3.1:8:81797084:81813373:-1 gene:ENSOARG00000004438 transcript:ENSOART00000004831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVKTIGLREVWYFGLQYVDNKGFPTWLKLDKKVSAQEVRKESPLQFKFRAKFYPEDVAEE
LIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKELHKAGYLGSERL
IPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDSAMLEYLKIAQDLEMYGINYFEIKNKK
GTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAP
RLRINKRILQLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRET
VEREKEQMMREKEELMLRLQDYEEKTRKAEKELSDQIQRALKLEEERKRAQEEAGRLEAD
RLAALRAKEELEIIWASVPSPLRGCPMATELAEYTAKIALLEEARRRKENEVEEWQLRAK
EAQDDLVKTREELHLVMTAPPPPPVYEPVNYHVHEGPQEEGTELSAELSSEGILDDRNEE
KRITEAEKNERVQRQLMTLTNELSQARDENKRTHNDIIHNENMRQGRDKNKTLRQIRQGN
TKQRIDEFETM
Download sequence
Identical sequences W5P2V0
ENSOARP00000004750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]