SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000006279 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000006279
Domain Number 1 Region: 61-543
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.19e-130
Family Pyridoxal-dependent decarboxylase 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000006279   Gene: ENSOARG00000005851   Transcript: ENSOART00000006374
Sequence length 543
Comment pep:novel chromosome:Oar_v3.1:23:59511142:59541662:1 gene:ENSOARG00000005851 transcript:ENSOART00000006374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLEECGYSLANKKQMRKKSIHACQSTDKDVIKEAHAENLMTNLSNAYASDLLPSKEGED
LTKCFLLRVVNILLHYIEKTFDVKSKILDFHHPHQLLEGLDGFDLELSDHPESLEQLLVD
CTDTLKYGVKTGHPRYFNQLSSGLDVIGLAGEWLTATANTNMFTYEIAPVFTVMETVLLK
KMCEIIGWRETEADGIFSPGGSISNLYGILVARYKQYPEIKARGMAVLPCIVLFVSEQGH
YSIRKAAATLGIGTDNVIEVKCDERGKMIPAELEKNILQAKRKGQTPFCVVATAGSTVFG
AFDPLHDIADICEIHRLWMHVDAAWGGGLLLSRTHSYKLSGIERADSVTWNPHKLMGVPL
QCSALLTREKGLLGACNQMQAEYLFQPDKVYNINFDTGDKTIQCGRHVDVFKLWLMWKAK
GTYGFEVQIDRYMELAKYFYKVLKKKDNFKLVFDAEPEFTNVCFWYFPPRLKHIPESFER
DQELQKIAPKIKAQMIVEGTVMLSYQPCGDKVNFFRMVFSNPATRQTDVDYLIDEIQRLG
KDL
Download sequence
Identical sequences W5P775
ENSOARP00000006279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]