SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000006635 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000006635
Domain Number 1 Region: 926-1060,1120-1186
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.41e-40
Family Hemopexin-like domain 0.00077
Further Details:      
 
Domain Number 2 Region: 68-107
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000126
Family Somatomedin B domain 0.0012
Further Details:      
 
Domain Number 3 Region: 26-66
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000275
Family Somatomedin B domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000006635   Gene: ENSOARG00000006194   Transcript: ENSOART00000006738
Sequence length 1186
Comment pep:known_by_projection chromosome:Oar_v3.1:12:65474993:65490481:1 gene:ENSOARG00000006194 transcript:ENSOART00000006738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWKILPIYLLLLSVFLIQQASSQDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDFK
KECTVELSCKGRCFESFARGRECDCDSDCKKYGKCCSDYGTFCEAVHNPTPPPPPKTAPP
PPGASQTIKSTTKRSPKSPNKKKTKKVIESEEITEEHSVSENQESSSSSSSSSSTIRKIK
SSKNSADNRELKKKPKVKDKKKRTPKNKPTLEPPVIDEGGSGLDNGDFKLTPTPIIPTTQ
RNKVTTTPKITTVKPTLPKPSLPPNSDTTKEIPSTVRETTVETKETSTTSKQTSTSAKEK
TTSAKETRTAENTSTKGLAPTPEAPATSTPKAKTITRSPTPTTPKKPTPTTKEPAPTTTT
TKEPAPTTTKEPAPTTTKEPAPTTTKEPAPTTTKEPAPTTTKEPAPTTTKEPAPTTTKEP
APTTTKEPAPTTTKEPAPTTTKEPAPTTTKEPAPTTTKEPAPTTTKEPAPTTTKEPAPTT
TKEPAPTTTXPPPTPQAPAPTPTKEPPPTTPKEPAPTTPKEPAPTAPKEPPAPTTTAAAP
APTTAPDAPPTPPKEPVPTTPKKPAPTIPEEPAPTTPKEPAPTSPKEPAPTTTPKEPAPT
TPKEPAPTIPKEPAPAKPKEPTPNFPETPAPSSPDIPAPTTSKASTSTTAMQPATTPKSP
AESTPQPPIEPTPKALGKSPKEPAVPTIKAPKVNKPEMTTTVKDKSTEEDIHPTPEITTA
VAKIVTEAATKTEKTTESKTPSTTTGVTSTTTKQTTSSKITPKTTLAPKVMTATKTTTKK
TANKPEKTTAVPKGTATNSQVTTPKPQKPTKAPKKPTSTKKPTPRVRKPKTTPTPPKMTS
VMPEPTPTSLPEAMLQTTTSPTPTPNSEIIEVNPKNEDGDAAEGEKPHVIFRPPVLTPIV
IPGTEIIVRGHGQGFGINPMFSDETNLCNGRPVDGLTTLRNGTLVAFRGHYFWMLTPFSP
PPPPRRITEVWGIPSPIDTVFTRCNCEGKTFFFKGSQYWRFTNDIKDAGYPKLISKGFGG
LNGKIVAALSIAQYKNRPESVYFFKRGGSVQQYTYKQEPTQKCTGRRPAINYSVYGETAQ
VRRRRFERAIGPSQIHTIRIHYSPVRVPYQDKGFLHNEVKVSTLWRGLPNVVTSAISLPN
VRKPDGYDYYAFSKDQYYNIDVPSRTARAITTRSGQTLSNTWYKCP
Download sequence
Identical sequences W5P880
ENSOARP00000006635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]