SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000006733 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000006733
Domain Number 1 Region: 102-514
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.6e-119
Family Pyridoxal-dependent decarboxylase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000006733   Gene: ENSOARG00000006286   Transcript: ENSOART00000006837
Sequence length 568
Comment pep:known_by_projection chromosome:Oar_v3.1:25:26793265:26845326:1 gene:ENSOARG00000006286 transcript:ENSOART00000006837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSTDLMSLKAFEPYFEILEVYSTKAKNYVNGHCTKYEPWQLIVWSVVWTLLIVWVYEFV
FQPESLWSRFKKRCFKLIRKMPVIGRQIQDKLNKTKEDISKNMSFLKVDQDYVKALPPQG
LSPAAVLEKLKEYSSKDVLWQEGKASGAVYSGEKELTDLLVKAYGDFAWSNPLHPDIFPG
LRKIEAEIVRMACSLFNGGPDSCGCVTSGGTESILMACKAYRELAFENGIKTPEIVAPQS
AHAAFDKAASYFGMKIIRVPLNKMMEVDVRAMRRAISRNTAMLVCSAPQFPHGVIDPIPE
VAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEQPFDFRVKGVTSISADTHKYGYAPKG
SSVVLYSDKKYRRYQFFVATDWQGGIYASPTIAGSRPGGISAACWASLMYFGESGYVEAT
KQIIKTTRFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLFNLMHAKGWNLNQLQFP
PSLHFCITLVHTRKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQATVDRNLVAE
LSSVFLDSLFSTDTVAQGSQMNGSPKPR
Download sequence
Identical sequences W5P8H8
ENSOARP00000006733 XP_011960615.1.66739 XP_011960616.1.66739 XP_011960617.1.66739 XP_011960618.1.66739 XP_011980853.1.54773 XP_011980854.1.54773 XP_011980855.1.54773 XP_011980856.1.54773 XP_011980857.1.54773 XP_011980858.1.54773 XP_014959898.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]