SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007556 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007556
Domain Number 1 Region: 253-344
Classification Level Classification E-value
Superfamily TAFH domain-like 5.62e-33
Family TAFH domain-like 0.0000319
Further Details:      
 
Domain Number 2 Region: 661-709
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000251
Family TBP-associated factors, TAFs 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007556   Gene: ENSOARG00000007045   Transcript: ENSOART00000007669
Sequence length 871
Comment pep:known_by_projection chromosome:Oar_v3.1:23:30820102:30917935:-1 gene:ENSOARG00000007045 transcript:ENSOART00000007669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAGLTEPAGAAPPAGVGASGTVTMAPAAALPVRVESTPVALGAVTKAPVSVCVESSVSQ
PLRSPVGTLVTKVAPVSALPKLSNGPRLPSPQIVAVKAPNTTTIQLPANLQLPPGTVLIK
SNSGQLMLVSPQQAVTRTETTSNITSRPAVPANTQTVKICTMPNSSSQLIKKVAVAPVKQ
LAQGGTSVVTSVPKPSPVQSVAVPANVVTVTPVKPVNTVTTLKPSSVGTASAPSNELNLK
TENSASAQANLSPTMLENVKKCKNFLAMLIKLACSGSQSPEMGQNVKKLVEQLLDAKIEA
EEFTRQLYVELKSSPQPHLVPFLKKSVIALRQLMPNAQSFIQQCVQQTSSEVVTTTCTTS
TPSPVVTTAASSIQAEKPVGGGSEAAVPGVVSVQTLKPLAGPGGAKTGVVTLHSVGPAAV
PGGTTAGAVVLQTPKPLVTSLQNTVTALQNTVTAVSLQPEKPVVSGTAVTLALPSVPFGK
TSAAAVCIPSVKPILTSTGTTSDKPALGPPLQIKLAQPGSVLAQPAGIPQAVKVKQLVVQ
QPSGGLAKQVTTLTHSPALTIQKSGQKKVTVSTTIPTSQFSQASILKQITLPGNKILSLQ
SSVQKNKIKENGTISFSRDEDDINDVTSMAGVNLSEENACILATNSELVGTLVQSCKDEP
FLFIGALQKRILDIGKKHDITELNSDAVNLISHATQERLRGLLEKLTTIAQHRMTTYKAS
ENYILSNDTRSQLKFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKEL
QQLELAQIQQRDANLTALAAIGPRKKRPLESGSGSEGLKDNLFASGTSSLAASKQLVRPR
ITRICLRDLIFCMEQERDMKYSRALYLALLK
Download sequence
Identical sequences W5PAU5
ENSOARP00000007556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]