SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000008393 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000008393
Domain Number 1 Region: 341-441
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.06e-24
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 157-211,239-258
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.82e-16
Family N-terminal PAS domain of Pas kinase 0.054
Further Details:      
 
Domain Number 3 Region: 72-129
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.27e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000008393   Gene: ENSOARG00000007809   Transcript: ENSOART00000008515
Sequence length 627
Comment pep:known chromosome:Oar_v3.1:15:38890197:38925292:-1 gene:ENSOARG00000007809 transcript:ENSOART00000008515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQRMDISSTISDFMSPGATDLLSSPLGTGGVDCNRKRKGSSTDYQESMDTDKDDPHGR
LEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQ
HMKTLREGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKI
LNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRL
CSGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLD
EDNEPDNEGCNLSCLVAIGRLHSHMVPQPANGEIRVKSMEYVSRHAIDGKFVFVDQRATA
ILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSR
WFSFMNPWTKEVEYIVSTNTVVLANVLEGGDPSFPQLTASPHSMDSMLPSGEGGPKRIHP
TVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKK
ILNGGTPDIPSSGLLPGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAA
MAVIMSLLEADAGLGGPVDFSDLPWPL
Download sequence
Identical sequences W5PD81
ENSOARP00000008393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]