SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014242 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014242
Domain Number 1 Region: 200-340
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-44
Family Third domain of FERM 0.000000176
Further Details:      
 
Domain Number 2 Region: 89-199
Classification Level Classification E-value
Superfamily Second domain of FERM 6.28e-38
Family Second domain of FERM 0.000000679
Further Details:      
 
Domain Number 3 Region: 495-582
Classification Level Classification E-value
Superfamily Moesin tail domain 3.14e-33
Family Moesin tail domain 0.0000208
Further Details:      
 
Domain Number 4 Region: 3-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.61e-26
Family First domain of FERM 0.00000805
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014242   Gene: ENSOARG00000013286   Transcript: ENSOART00000014449
Sequence length 582
Comment pep:known_by_projection chromosome:Oar_v3.1:15:19764545:19821782:-1 gene:ENSOARG00000013286 transcript:ENSOART00000014449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPRKINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLK
LNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPE
TAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHR
GMLSREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIG
FPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDT
IEVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERLRQIEEQTM
KAQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAKSALAKQAADQMKNQEQLAA
ELAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPVIPP
TENEHDEHDENNAEASAELSNDGVMNHRSEEERVTETQKNERVKKQLQALSSELAQARDE
TKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAM
Download sequence
Identical sequences W5PUW0
ENSOARP00000014242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]