SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015818 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015818
Domain Number 1 Region: 9-486
Classification Level Classification E-value
Superfamily ALDH-like 9.95e-162
Family ALDH-like 0.0000000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015818   Gene: ENSOARG00000014749   Transcript: ENSOART00000016051
Sequence length 487
Comment pep:known_by_projection chromosome:Oar_v3.1:8:59987597:60013962:-1 gene:ENSOARG00000014749 transcript:ENSOART00000016051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRGGLLMLENFIGGKFLPCSSYLDSYDPSTGEVYCRVPNSGKEEVDAAVEAARAAFPG
WSSRSPQERSQVLQRLADLLEQSLEELAQAESKDQGKTVTLARTMDIPRAVQNFRFFASS
ILHHTSECTQMDHLGCLHYTVRAPAGIAALISPWNLPLYLLTWKIAPAIAAGNTVIAKPS
ELTSVTAWMMCRLLEKAGVPPGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERIT
QLSAPHCKKLSLELGGKNPAIIFEDANLAECIPTTVRSSFANQGEICLCTSRIFVQKSIY
SEFLKRFVEATRMWKVGIPSDPSADMGALISKAHLEKVRSYIKKARMEGAQILCGEGVDK
LNLPPRNQGGYFMLPTVITDVKDESCCMKEEIFGPVTCVVPFDSEEEVIQRANNVKYGLA
ATVWSGNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGVGREGAKDSYEFFTEV
KTITVKH
Download sequence
Identical sequences W5PZD2
XP_004011402.1.66739 ENSOARP00000015818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]