SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016514 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016514
Domain Number 1 Region: 370-472
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.65e-27
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.002
Further Details:      
 
Domain Number 2 Region: 99-182
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000288
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 181-235,262-277,305-317
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000168
Family BphP N-terminal domain-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016514   Gene: ENSOARG00000015391   Transcript: ENSOART00000016749
Sequence length 751
Comment pep:known_by_projection chromosome:Oar_v3.1:18:25331556:25480510:1 gene:ENSOARG00000015391 transcript:ENSOART00000016749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKEGPVPRSPGSPPRWCFCSAGQFFCSFLDFSVINKTSLCRITEMASDIPGSVTLPVAP
MAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGPSKFSRENHSEIERRRRNKMTQYITEL
SDMVPTCSALARKPDKLTILRMAVSHMKSMRGTGNKSTDGAYKPSFLTEQELKHLILEAA
DGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFGSTLYEQVHPDDVEKLREQLCTSENSM
TGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGNAPLDHLPLNRLTTMRKRFRNG
LGPVKEGEAQYAVVHCTGYIKAWPPAGMTIPEEDADVGQGSKYCLVAIGRLQVTSSPVCM
DMSGMSVPTEFLSRHNSDGIITFVDPRCISVIGYQPQDLLGKDILEFCHSEDQSHLRESF
QQVVKLKGQVLSVMYRFRTKNREWVLIRTSSFTFQNPYSDEIEYIICTNTNVKQLQQQQA
ELEVHQRDGLSSYDLSQVPVPNLPAGVHDAGKSVEKADAIFSQERDPRFAEMFAGISASE
KKMMSSASAAGTQQIYSQGSPFPAGHSGKAFSSAVVHVPGVNDIQSSSSTSQNMSQISRQ
LNQSQVAWTGSRPPFPGQQIPSQSSKTQSSPFGIGTSHTYPADPSSYSPLSSPATSSPSG
NAYSSLANRTPGFAESGQSSGQFQGRPSEVWSQWQSQHHGQQSGEPHSHQQPGQTEVFQD
MLPMPGDPTQGTGNYNIEDFADLGMFPPFSE
Download sequence
Identical sequences W5Q1C8
ENSOARP00000016514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]