SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016803 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016803
Domain Number 1 Region: 217-380,413-475
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.02e-38
Family Voltage-gated potassium channels 0.0034
Further Details:      
 
Domain Number 2 Region: 480-662
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.06e-36
Family cAMP-binding domain 0.00089
Further Details:      
 
Domain Number 3 Region: 36-134
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.33e-18
Family Flavin-binding PAS domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016803   Gene: ENSOARG00000015658   Transcript: ENSOART00000017041
Sequence length 1103
Comment pep:known_by_projection chromosome:Oar_v3.1:1:274437433:274900449:1 gene:ENSOARG00000015658 transcript:ENSOART00000017041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGLLAPQNTFLDTIATRFDGTHSNFILANAQVAKGFPIVYCSDGFCELAGFARTEVMQK
SCSCKFLFGVETNEQLMLQIEKSLEEKTEFKGEIMFYKKNVAGSPFWCLLDIVPIKNEKG
DVVLFLASFKDITDTKVKITPEDKKEDKAKGRSKAGAHFDSARRRSRAVLYHISGHLQRR
EKNKLKISNNVFVDKPAFPEYKVSDAKKSKFILLHFSTFKAGWDWLILLATFYVAVTVPY
NVCFIGNDDLSTTRSTTVSDIAVEILFIIDIILNFRTTYVSKSGQVIFEARSICIHYVTT
WFIIDLIAALPFDLLYAFNVTVVSLVHLLKTVRLLRLLRLLQKLDRYSQHSTIVLTLLMS
MFALLAHWMACIWYVIGKMEREDNSLLKWEVGWLHELGKRLESPYYGNNTLGGPSIRSAY
IAALYFTLSSLTSVGFGNVSANTDAEKIFSICTMLIGALMHALVFGNVTAIIQRMYSRWS
LYHTRTKDLKDFIRVHHLPQQLKQRMLEYFQTTWSVNNGIDSNELLKDFPDELRSDITMH
LNKEILQLSLFECASRGCLRSLSLHIKTSFCAPGEYLLRQGDALQAIYFVCSGSMEVLKD
STVLAILGKGDLIGANLSIKDQVIKTNADVKALTYCDLQCIILKGLFEVLDLYPEYAHKF
VEDIQHDLTYNLREGHESDVISRLSNKSTVSQSEPKGNGSIKKRLPSIVEDEEEEDDEGE
ETASLSPVYTRAPASSRSKRPGGGKSYLGLSLKQLASGTVPFHSPIRVSSSNSPKTKQEM
DAPNYGRRKENLKLQLSTWNSAGPPDLSPRIVDGIEDGNSSEESQTFDFGSERIRPEPRI
SPPLGDPEIGAAVLFIKAEETRQQISKLNSEVTTLTQEVSQLGRDMKTVMQLLEHVLSPQ
QQSRLCSLHTASLRPSSFQGGMTWSTHQPCLHLQAAGAAYTPAQLCQGSVTPERWSVGPS
SAGGSPLQTGAQEQSPAGVELRASPSLDHAPAHCQVVQEGRLQLLRCISPQSDTTLTPLQ
SISATLSSSACSSSETSLHLVLPSRSEEGSLGQGAMSSFSLENLPGSWERERRASISTDP
LESFPLEMVSSTAEGKDGRAGHV
Download sequence
Identical sequences W5Q265
ENSOARP00000016803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]