SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000017905 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000017905
Domain Number 1 Region: 48-506
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.76e-130
Family Pyridoxal-dependent decarboxylase 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000017905   Gene: ENSOARG00000016670   Transcript: ENSOART00000018156
Sequence length 507
Comment pep:novel chromosome:Oar_v3.1:3:133174198:133183260:1 gene:ENSOARG00000016670 transcript:ENSOART00000018156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITPALLTDFLLMADSQPFLSLDGDPVAAEALLQDVFGIVVDEVIRKGTSASEKVCEWKEP
EELKQLLDLELRHEGESQEQILEHCRAVIRYSVKTCHPRFFNQLFSGLDPHALAGRIVTE
SLNTSQYTYEIAPVFVLMEEEVLKKLRALVGWSSGDGVFCPGGSISNMYAVNLARYQRYP
DCKQRGLRALPPLALFTSKECHYSIKKGAAFLGLGTDSVRVVEADERGKMIPEDLERQIS
LAKAEGAVPFLVSATSGTTVPGAFDPLEAIADVCQHHGLWLHVDAAWGGSVLLSQTHRHL
LAGIQRADSVAWNPHKLLSTGLQCSALLLRDTSDTSNLLKRCHGSQASYLFQQDKFYDVA
LDTGDKVVQCGRRVDCLKLWLMWKAQGGQGLQRRVDQAFALARYLVEELKKREGFELVME
PEFVNVCFWFVPPSLRGKKESPDYSERLSKVAPILKERMVRKGSMMIGYQPHGTRSNFFR
MVVANPALTRADMDFLLNELERLGQDL
Download sequence
Identical sequences W5Q5B5
ENSOARP00000017905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]