SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000019063 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000019063
Domain Number 1 Region: 259-437
Classification Level Classification E-value
Superfamily ITPase-like 1.35e-30
Family YjjX-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000019063   Gene: ENSOARG00000017766   Transcript: ENSOART00000019331
Sequence length 445
Comment pep:known_by_projection chromosome:Oar_v3.1:5:23935691:23979087:-1 gene:ENSOARG00000017766 transcript:ENSOART00000019331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEESGIETTPPGTPPPNPGGLASAALSSSPAPLAAASTFSSPSGSSVQSLPPQVFSTPQ
PSLPPVQPAAPLPFVPSSPVPSVPPLVTSLPPPVSPPTGAAFSHPPLSHFPPSTSAPNTL
LSAPPSGPPTSGFSVGSAYDITRGHAGRAPQTPLMPSFSAPPVTGILPTPITQQAGLTSV
AQGTGTTSAITFPEEQEDPRIGRSQDEASAGGLWGFIKGVAGNPMVKSVLDKTKHSVESM
ITTLDPGMAPYIKSGGELDIVVTSNKEVKVAAVRDAFQEVFGLAVVIGEAGQSNIAPQPV
GYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIAELLPDKWFDIGCLIVEDPVHGIHL
EAFTQATPVPLEFVQQAQSLTPQDYNLRWSGLLVTVGEVLEKSLLNVSRTDWHMAFTGMS
RRQMIYSAAKAIAGMYKQRLPPRTV
Download sequence
Identical sequences W5Q8M1
XP_004008706.1.66739 XP_011985537.1.54773 ENSOARP00000019063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]