SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020130 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020130
Domain Number 1 Region: 511-695
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.36e-35
Family cAMP-binding domain 0.001
Further Details:      
 
Domain Number 2 Region: 224-385,446-478
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.13e-29
Family Voltage-gated potassium channels 0.0066
Further Details:      
 
Domain Number 3 Region: 41-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.6e-22
Family Flavin-binding PAS domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020130   Gene: ENSOARG00000018744   Transcript: ENSOART00000020409
Sequence length 1074
Comment pep:known_by_projection chromosome:Oar_v3.1:3:136520560:136538460:-1 gene:ENSOARG00000018744 transcript:ENSOART00000020409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAMRGLLAPQNTFLDTIATRFDGTHSNFVLGNAQVAGLFPVVYCSDGFCDLTGFSRAEV
MQRGCACSFLYGPDTSELVRQQIRKALDEHKEFKAELILYRKSGLPFWCLLDVIPIKNEK
GEVALFLVSHKDISETKNRGGPDSWKESGGGRRRYGRGGSKGFNANRRRSRAVLYHLSGH
LQKQPKGKHKLNKGVFGEKPNLPEYKVAAIRKSPFILLHCGALRATWDGFILLATLYVAV
TVPYSVCVSTAREPSAARGPPSVCDLAVEVLFILDIVLNFRTTFVSKSGQVVFAPKSICL
HYVTTWFLLDVIAALPFDLLHAFKVNVYFGAHLLKTVRLLRLLRLLPRLDRYSQYSAVVL
TLLMAVFALLAHWVACVWFYIGQREIESSASELPEIGWLQELARRLETPYYLVGRSSAAG
NSSGQSDNCSSSFGEANRTGPELLGGPSLRSAYITSLYFALSSLTSVGFGNVSAHTDTEA
PGGAARRPGPLLACGRTPRAWPPTPRPFTPRRFLYHSRTRDLRDYIRIHRIPKPLKQRML
EYFQATWAVNSGIDANELLQSLPDELRADIAMHLHKEVLQLPLFEAASRGCLRALSLALR
PAFCTPGEYLIHQGDALQALYFVCSGSMEVLKGGTVLAILGKGDLIGCELPRREQVVKAN
ADVKGLTYCVLQCLQLAGLHESLALYPEFAPRFSRGLRGELSYNLGAGGGPAEVRALCLC
VGGLEAWGVGEGPTSSLPPLHHSGHAVLRTLAVSHRSSWKLQAPRGKGTTCSTLLLGPQA
PGLAPALVASVNSGASCPVKQNTAICCPGACVHRVVDGIEDGCGSDQPKFSFRVRHSGPE
CSSSPSPGPENGLLTVPLGPSEVRNTDTLDKLRQAVMELSEQVLQMREGLQSLRQAVQLV
LAPHGEGPCPREKGEGPCPAGASGLLQPLCVDTGVSSYCLQPSAGSVLSGTWPHPRPGPP
PLVAPWPWGPPASQSSPWPRATAFWTSTSDSEPPGSGEPCPEPSTPGSPPPEEGARTGPP
EPATQAEAASTGGAPPPASGGHALPWEPHSLEMVLIGCHGSGAAQWAQEEGTGV
Download sequence
Identical sequences W5QBN3
ENSOARP00000020130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]