SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020184 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020184
Domain Number 1 Region: 221-388,420-483
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-32
Family Voltage-gated potassium channels 0.0038
Further Details:      
 
Domain Number 2 Region: 486-675
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.1e-31
Family cAMP-binding domain 0.00061
Further Details:      
 
Domain Number 3 Region: 40-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.01e-25
Family Flavin-binding PAS domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020184   Gene: ENSOARG00000018790   Transcript: ENSOART00000020464
Sequence length 1043
Comment pep:known_by_projection chromosome:Oar_v3.1:11:41768994:41784713:-1 gene:ENSOARG00000018790 transcript:ENSOART00000020464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVMKGLLAPQNTFLDTIATRFDGTHSNFLLANAQGPRGFPIVYCSDGFCELTGYGRTEV
MQKTCSCRFLYGPETSEPALQRLHKALEGHQEHRAEICFYRKDGSAFWCLLDMMPIKNEM
GEVVLFLFSFKDITQSRGPGLGPPGGHGDSNHENSLGRRGASSRLRSARRQSRTVLHRLT
GHFGRRGQGGMKTNNVFEPKPSVPEYKVASVGGSRCLLLHYSVPKAVWDGLILLATFYVA
VTVPYNVCFSGDDDTPITSRHTLVSDIAVEMLFILAPDIILNFRTTYVSQSGQVVSAPRS
IGLHYLATWFFVDLIAALPFDLLYVFNITVTSLVHLLKTVRLLRLLRLLQKLERYSQCSA
VVLTLLMSVFALLAHWMACVWYVIGRREMEANDPLLWDIGWLHELGKRLEVPYVNGSAGG
PSRRSAYIAALYFTLSSLTSVGFGNVCANTDAEKIFSICTMLIGGTLMHAVVFGNVTAII
QRMYSRRSLYHSRMKDLKDFIRVHRLPRPLKQRMLEYFQTTWAVNSGIDANELLRDFPDE
LRADIAMHLNREILQLPLFGAASRGCLRALSLHIKASFCAPGEYLLRRGDALQAHYYVCS
GSLEVLRDNMVLAILGKGDLIGADIPEPGSGTAPSCVLKTSADVKALTYCGLQQLSSQGL
AEVLRLYPEYGAAFRAGLPRDLTFNLRHGSETNGLCRFSRSPRLSQPRSDSLGSSSDKTQ
PSLGEELPPFSALVSSPSLSPAPSPALAGRGHSPSPHSPPLSPSACSALLWPLLSARGTD
DHCLHPRIVDGIEDSGSTAEATTFRFSRRPEHPRSRSQAPPTGKGQQWTSTHSHPPTIHL
TREVWPEKEGLSTDKGFAPADLKATSTAQPGPALGNGPSLGSDKHQASPGVHLGGAGPGA
GGRTSPGSAGFKISRLNREVSQLSQELRHMMGLLQARLGPPGHPTVSAWPPHPPCPPQRP
PCSSPYMSGPPPGLHDTTRAEVHCPASVGTAEMGAAPPNLQPSVRSPYLSEPDPLGPFPV
PEALPPNSSLMRHNFRSRSDTIH
Download sequence
Identical sequences W5QBT7
ENSOARP00000020184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]