SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020200 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020200
Domain Number 1 Region: 5-419
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 4.36e-163
Family Phosphoglycerate kinase 0.00000000000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020200   Gene: ENSOARG00000018803   Transcript: ENSOART00000020480
Sequence length 420
Comment pep:known chromosome:Oar_v3.1:X:65709703:65731937:1 gene:ENSOARG00000018803 transcript:ENSOART00000020480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKYCLDSGAKSVVL
MSHLGRPDGVPMPDKYSLQPVAVELKSLLGKDVLFLKDCVGPEVEKACADPAAGSVILLE
NLRFHVEEEGKGKDASGNKVKAEPTKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
LPKKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLISNMLDKVNEMIIGGGM
AFTFLKVLNNMEIGTSLFDEEGSKIVKDLMSKADKNGVKITLPVDFVTADKFDENAKTGQ
ATVASGIPVGWMGLDCGPESSKKYAEAVARAKQIVWNGPVGVFEWEAFARGTKALMDEVV
KATSRGCITIIAGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEETGKVLPGVDALSSV
Download sequence
Identical sequences W5QBV3
ENSOARP00000020200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]