SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000022431 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000022431
Domain Number 1 Region: 362-464
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.17e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 173-227,254-269,297-315
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.95e-16
Family BphP N-terminal domain-like 0.051
Further Details:      
 
Domain Number 3 Region: 91-174
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 4 Region: 570-735
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.0000000577
Family Tetraviridae-like VP 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000022431   Gene: ENSOARG00000020870   Transcript: ENSOART00000022737
Sequence length 790
Comment pep:known_by_projection chromosome:Oar_v3.1:1:99680911:99747432:-1 gene:ENSOARG00000020870 transcript:ENSOART00000022737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATTANPEMTSDVPPLGPAIASGNPGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFL
RCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCS
ALARKPDKLTILRMAVSHMKSLRGTGNTSTDGTYKPSFLTDQELKHLILEAADGFLFIVS
CETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLK
TGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDSVSMNRLSFVRNRCRNGLGSAKDGE
PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQP
TEFISRHNIEGLFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKG
QVLSVMFRFRSKNREWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPSLSNTIQ
RPQLGPTANLSLEMGSGQLAPRQQQQQTELDVVPGRDGLTSYNHSQVSVQPVTTTGPEHS
KPLEKSESLFAQDRDPRFSEIYSNISTDQSKGISSSTVPATQQLFSQGNTFPPTPRPAEN
FRNSGLAPPVTIVQPSTSAGQMLAQISRHSNPTQGAAPAWTPSTRPGFSPQQVATQATAK
TRSSQFGVGSFQTPSSFSPMSLPGASTASPGAAAYPSLTSRGSNFAPETGQAAGQFQTRT
AEGVGVWPQWQGQQSHHRSSSNEQHVQQPSAQQPGQPEVFQEMLSMLGDQSNSYNNEEFP
DLTMFPSFSE
Download sequence
Identical sequences T2K1D9
ENSOARP00000022431 NP_001274394.1.54773 NP_001274394.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]