SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525946066|ref|YP_008307112.1| from Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525946066|ref|YP_008307112.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 9.58e-111
Family FMN-linked oxidoreductases 0.0000000000458
Further Details:      
 
Domain Number 2 Region: 333-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.18e-40
Family N-terminal domain of adrenodoxin reductase-like 0.000000994
Further Details:      
 
Domain Number 3 Region: 461-518,556-650
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.25e-27
Family C-terminal domain of adrenodoxin reductase-like 0.00000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|525946066|ref|YP_008307112.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase [Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189]
Sequence
MSYPSLFAPLDLGFTTLRNRVLMGSMHTGLEEHPDGAERLAAFYAERARHGVALIVTGGI
APVPSGVVMTGGAMLNDASQLTPHRVVTDAVHAQGGKIALQILHTGRYSYQPHLVAPSAI
QAPINRFMPHELTHDEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTRRTNHR
DDEWGGDYTSRMRFAVEVVRAVRQRVGNDFIIIYRLSMLDLVENGGTFDETVQLAQAIEA
AGASLINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSVPLIATNRINDPQVAETIL
TRGDADMVSMARPFLADAEFLTKAQSGRADEINTCIGCNQACLDRIFIGKVTSCLVNPRA
CHETHMPIAPAIRKKNLAVVGAGPAGLAFAINAASRGHHVTLFDAQSEIGGQFTIARQIP
GKEEFYETLRYYRRMIDVTGVTLKLSQRVNAEDLQPFDEAILACGIVPRRPPIDGIDHPK
ALTYLEVLRDKAPVGKRVAIIGCGGIGFDTAMYLSQHGESTSQNIAEFCTEWGIDTSLQQ
AGGLRPEGPRLARSPRQIVMLQRKASKPGEGLGKTTGWIHRATLLARGVKMIPAVSYQKI
DDDGLHLLIGGEPQLLEVDHVVICAGQEPRRELADPLRAAGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences gi|525946066|ref|YP_008307112.1| WP_020839011.1.100115 WP_020839011.1.100870 WP_020839011.1.12244 WP_020839011.1.12584 WP_020839011.1.14286 WP_020839011.1.14516 WP_020839011.1.16819 WP_020839011.1.17390 WP_020839011.1.20034 WP_020839011.1.20721 WP_020839011.1.2224 WP_020839011.1.23466 WP_020839011.1.23643 WP_020839011.1.23685 WP_020839011.1.24325 WP_020839011.1.26030 WP_020839011.1.2634 WP_020839011.1.2660 WP_020839011.1.27279 WP_020839011.1.27556 WP_020839011.1.30573 WP_020839011.1.31107 WP_020839011.1.31762 WP_020839011.1.32747 WP_020839011.1.33078 WP_020839011.1.33609 WP_020839011.1.34667 WP_020839011.1.38001 WP_020839011.1.39385 WP_020839011.1.42957 WP_020839011.1.44996 WP_020839011.1.46028 WP_020839011.1.46286 WP_020839011.1.46574 WP_020839011.1.46666 WP_020839011.1.47649 WP_020839011.1.47814 WP_020839011.1.48209 WP_020839011.1.48570 WP_020839011.1.48886 WP_020839011.1.48985 WP_020839011.1.49304 WP_020839011.1.49472 WP_020839011.1.50469 WP_020839011.1.50563 WP_020839011.1.52438 WP_020839011.1.53935 WP_020839011.1.54569 WP_020839011.1.56853 WP_020839011.1.56893 WP_020839011.1.57307 WP_020839011.1.58040 WP_020839011.1.59336 WP_020839011.1.59641 WP_020839011.1.59830 WP_020839011.1.60919 WP_020839011.1.6164 WP_020839011.1.63568 WP_020839011.1.63934 WP_020839011.1.64007 WP_020839011.1.65016 WP_020839011.1.65027 WP_020839011.1.66807 WP_020839011.1.67288 WP_020839011.1.68532 WP_020839011.1.69636 WP_020839011.1.70248 WP_020839011.1.70321 WP_020839011.1.7110 WP_020839011.1.71446 WP_020839011.1.7174 WP_020839011.1.71756 WP_020839011.1.72226 WP_020839011.1.72689 WP_020839011.1.73831 WP_020839011.1.75402 WP_020839011.1.76097 WP_020839011.1.76364 WP_020839011.1.78201 WP_020839011.1.80529 WP_020839011.1.80586 WP_020839011.1.82841 WP_020839011.1.83650 WP_020839011.1.83854 WP_020839011.1.83979 WP_020839011.1.84355 WP_020839011.1.86453 WP_020839011.1.87875 WP_020839011.1.88303 WP_020839011.1.91470 WP_020839011.1.91903 WP_020839011.1.92729 WP_020839011.1.92975 WP_020839011.1.96335 WP_020839011.1.98899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]