SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525948507|ref|YP_008310143.1| from Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525948507|ref|YP_008310143.1|
Domain Number 1 Region: 48-356,437-466
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.99e-63
Family Type II chitinase 0.00021
Further Details:      
 
Domain Number 2 Region: 368-435
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000000058
Family Chitinase insertion domain 0.0041
Further Details:      
 
Domain Number 3 Region: 643-697
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.000000667
Family Carbohydrate binding domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|525948507|ref|YP_008310143.1|
Sequence length 699
Comment chitinase [Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189]
Sequence
MATSKLIQGDTITETTHAANGFDPATSDDKISYTSARVAKPVYNKYKNSTTKPKVFGYYT
DWSQYDSRLQGNMSQPGRGYDLTKVSPTAYDKLIFGFVGITGFRKIDTEDRDVVAEAAAL
CGKVKYEPTFLDPWGDFQSYINLGFDVSGWDVDPKTVTQSNAKGLLGALRDMQAKAKAAG
HTLALSMSIGGWSMSNGFHETAASDSSRKIFAKGVVKLFKQFPMFSEVDIDWEYPNNEGA
GNPFGPEDGANYALLIAELRKQLDSAGLSNVKISIAASAVTTIFDYAKVKDLMAAGLYGI
NLMTYDFFGTPWAETLGHHTNRKALEEGGWAVETIVDHLLAEGFSADRINIGYAGYTRNA
RQVEIESLSPLKGSYNPGSGPTTGSFESGTSEWYDVIYSYLDLENQKGRNGFNVYTDQVA
DADYLYSPESKLFLSLDTPRTVKAKGEYAAKLGLGGVFTWTIDQDNGVLVNAVREGLGYE
IESEVIDMEPFYFEGINVEKDEEQSDSDDAQKVNHAPKAAIELMVVGGSTVQLSGAGSSD
EDNDELSFSWGVPSQIDVADKTAEIIEVVVPEVSEKTAFQFTLFVRDCYNEPSSQQRFVL
TAVSALSQVQPEPEEEEEIIVPVPDEEEDTTPAEDDTPADDKTSPYAQWDASTVYGANWG
SFEIVSWKGHNYQVKWWSMGNQPDLNCGVGGAWTDLGAY
Download sequence
Identical sequences WP_020839623.1.100115 WP_020839623.1.12244 WP_020839623.1.12584 WP_020839623.1.14516 WP_020839623.1.16819 WP_020839623.1.20721 WP_020839623.1.23643 WP_020839623.1.23685 WP_020839623.1.26030 WP_020839623.1.2634 WP_020839623.1.31762 WP_020839623.1.34667 WP_020839623.1.38001 WP_020839623.1.42957 WP_020839623.1.46666 WP_020839623.1.47649 WP_020839623.1.48570 WP_020839623.1.48985 WP_020839623.1.49472 WP_020839623.1.52438 WP_020839623.1.53935 WP_020839623.1.56893 WP_020839623.1.57307 WP_020839623.1.58040 WP_020839623.1.59336 WP_020839623.1.59641 WP_020839623.1.59830 WP_020839623.1.60919 WP_020839623.1.6164 WP_020839623.1.64007 WP_020839623.1.68532 WP_020839623.1.69636 WP_020839623.1.70321 WP_020839623.1.71446 WP_020839623.1.7174 WP_020839623.1.72226 WP_020839623.1.73831 WP_020839623.1.76097 WP_020839623.1.76364 WP_020839623.1.76806 WP_020839623.1.78201 WP_020839623.1.80529 WP_020839623.1.82841 WP_020839623.1.83650 WP_020839623.1.83854 WP_020839623.1.84355 WP_020839623.1.87875 WP_020839623.1.91470 WP_020839623.1.92729 WP_020839623.1.92975 WP_020839623.1.96335 WP_020839623.1.98899 gi|525948507|ref|YP_008310143.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]