SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525947087|ref|YP_008308391.1| from Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525947087|ref|YP_008308391.1|
Domain Number 1 Region: 288-422
Classification Level Classification E-value
Superfamily CBS-domain pair 7.96e-23
Family CBS-domain pair 0.0062
Further Details:      
 
Domain Number 2 Region: 434-518
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 9.82e-17
Family CorC/HlyC domain-like 0.0023
Further Details:      
 
Weak hits

Sequence:  gi|525947087|ref|YP_008308391.1|
Domain Number - Region: 7-227
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00366
Family LacY-like proton/sugar symporter 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|525947087|ref|YP_008308391.1|
Sequence length 519
Comment membrane protein [Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189]
Sequence
MELLMDPSIWVGLLTLVVLEIVLGIDNLVFIAILADKLPPKQRDKARLIGLSLALIMRLA
LLSIISWLVTLTKPLFTVWDFTFSGRDLIMLLGGIFLLFKATTELHERLENREHDTGHGK
GYASFWVVVTQIVILDAVFSLDAVITAVGMVNHLPVMMAAVVIAMAVMLLASKPLTRFVN
QHPTVVVLCLSFLLMIGLSLVAEGFGFHIPKGYLYAAIGFSIVIEVFNQIARRNFIRHQS
TLPLRARTADAILRLMGGKRQASTQHETDSPAAISVSEGAFAEEERYMINGVLTLASRSL
RGIMTPRGEISWVDANLSVAEIRQQLLSSPHSLFPVCRGELDEIIGIVRAKELLVALEEG
ADVAAIAASSPAIVVPETLDPINLLGVLRRARGSFVIVTNEFGVVQGLVTPLDVLEAIAG
EFPDADETPEIVADAEGWIVKGGTDLHALQQALEVDHLVNEEGDIATVAGLVIAANGHIP
RVGDVIDVPPLRITIVEANDYRVDLVRIVKEQPAHDEEE
Download sequence
Identical sequences A0A0D6FT16 A0A0F6B2D5 A0A0F7J729 A0A0G2NLX8 A0A0H3NM59 A0A0L9ELD8 A0A0M0Q571 A0A0N1QTC0 A0A0T9W783 A0A0T9X850 A0A1C3A291 A0A1S0ZG51 A0A1S1AHJ2 A0A1X2UNZ6 A0A1X2YCD5 A0A1Z3QDG5 A0A221YLK6 A0A221YZC4 A0A265B5C0 A0A267SHU5 A0A271CMP1 A0A2C6EZX3 A0A2C9NYT4 A0A2D1XDJ9 A0A2D1XR36 A0A2D2Z6Q1 A0A2D3TV84 A0A2G1NR99 A0A2H9YB53 A0A2I6M7E1 A0A2I6MYP4 A0A2I6NCV5 A0A2I6NQJ8 A0A2I6P3Q9 A0A2K2ZYC8 B5F3R3 B5R8X3 E8X8J9 G4C2L9 M7RR90 Q8ZP05 S4IFZ4 S5HVW3 V1W383 V7IM90 V7UAP6
gi|550901183|ref|YP_008670275.1| ABAK02000001|CDS_1259083-1257524 ABAM02000001|CDS_2387980-2386421 ABAO01000080|CDS_649-2208 ABEI01000029|CDS_16918-18477 ABEJ01000013|CDS_126866-125307 ABEL01000002|CDS_514624-513065 ABFF01000008|CDS_76406-74847 ABFH02000002|CDS_165742-167301 AM933173|CDS_1351785-1353344 CP001120|CDS_1975868-1974309 CP001127|CDS_1906072-1904513 CP001138|CDS_1272573-1274132 CP001144|CDS_1439644-1441203 CP001363|CDS_1939465-1937906 FN424405|CDS_1921290-1919731 NZ_ACBF01000010|CDS_97445-99004 gi|563652750|ref|YP_008860813.1| gi|197248683|ref|YP_002146195.1| gi|205352506|ref|YP_002226307.1| gi|409249837|ref|YP_006885652.1| gi|378984390|ref|YP_005247545.1| gi|378450410|ref|YP_005237769.1| gi|525830036|ref|YP_008253267.1| gi|538362423|ref|YP_008505708.1| gi|198245489|ref|YP_002215311.1| gi|525857878|ref|YP_008261030.1| gi|525817715|ref|YP_008247733.1| gi|378955336|ref|YP_005212823.1| gi|379701004|ref|YP_005242732.1| gi|378445234|ref|YP_005232866.1| gi|378989169|ref|YP_005252333.1| gi|194734512|ref|YP_002114863.1| gi|526220430|ref|YP_008266037.1| 439843.SeSA_A1972 439851.SeD_A1487 454166.SeAg_B1303 454169.SeHA_C2029 550538.SG1289 gi|525947087|ref|YP_008308391.1| NP_460784.2.58477 WP_000421815.1.100002 WP_000421815.1.100007 WP_000421815.1.100010 WP_000421815.1.100017 WP_000421815.1.100031 WP_000421815.1.100077 WP_000421815.1.100115 WP_000421815.1.100129 WP_000421815.1.10013 WP_000421815.1.100165 WP_000421815.1.1002 WP_000421815.1.100234 WP_000421815.1.100258 WP_000421815.1.100288 WP_000421815.1.100376 WP_000421815.1.100392 WP_000421815.1.100412 WP_000421815.1.100413 WP_000421815.1.100424 WP_000421815.1.100432 WP_000421815.1.100436 WP_000421815.1.100438 WP_000421815.1.100457 WP_000421815.1.100472 WP_000421815.1.100484 WP_000421815.1.100488 WP_000421815.1.100519 WP_000421815.1.100521 WP_000421815.1.100541 WP_000421815.1.100557 WP_000421815.1.100589 WP_000421815.1.100597 WP_000421815.1.100605 WP_000421815.1.100642 WP_000421815.1.100650 WP_000421815.1.100714 WP_000421815.1.100721 WP_000421815.1.10074 WP_000421815.1.10076 WP_000421815.1.100773 WP_000421815.1.100776 WP_000421815.1.100781 WP_000421815.1.100790 WP_000421815.1.100793 WP_000421815.1.10081 WP_000421815.1.100857 WP_000421815.1.100865 WP_000421815.1.100869 WP_000421815.1.100870 WP_000421815.1.100871 WP_000421815.1.100882 WP_000421815.1.100895 WP_000421815.1.100932 WP_000421815.1.100944 WP_000421815.1.100948 WP_000421815.1.101007 WP_000421815.1.101020 WP_000421815.1.101074 WP_000421815.1.101078 WP_000421815.1.101094 WP_000421815.1.101112 WP_000421815.1.101147 WP_000421815.1.101180 WP_000421815.1.101185 WP_000421815.1.101199 WP_000421815.1.101259 WP_000421815.1.101284 WP_000421815.1.101291 WP_000421815.1.1013 WP_000421815.1.101353 WP_000421815.1.101386 WP_000421815.1.101404 WP_000421815.1.101420 WP_000421815.1.101425 WP_000421815.1.101454 WP_000421815.1.101473 WP_000421815.1.101519 WP_000421815.1.101520 WP_000421815.1.101541 WP_000421815.1.101589 WP_000421815.1.101612 WP_000421815.1.101636 WP_000421815.1.101639 WP_000421815.1.10164 WP_000421815.1.101666 WP_000421815.1.101707 WP_000421815.1.101734 WP_000421815.1.101759 WP_000421815.1.10177 WP_000421815.1.101776 WP_000421815.1.101815 WP_000421815.1.101839 WP_000421815.1.101868 WP_000421815.1.101878 WP_000421815.1.101917 WP_000421815.1.101927 WP_000421815.1.101949 WP_000421815.1.101953 WP_000421815.1.101975 WP_000421815.1.102009 WP_000421815.1.102103 WP_000421815.1.102111 WP_000421815.1.10220 WP_000421815.1.10231 WP_000421815.1.10266 WP_000421815.1.10276 WP_000421815.1.10293 WP_000421815.1.10300 WP_000421815.1.10394 WP_000421815.1.10429 WP_000421815.1.10439 WP_000421815.1.10463 WP_000421815.1.10465 WP_000421815.1.10507 WP_000421815.1.10562 WP_000421815.1.10566 WP_000421815.1.106 WP_000421815.1.10678 WP_000421815.1.10711 WP_000421815.1.10720 WP_000421815.1.10753 WP_000421815.1.10797 WP_000421815.1.10992 WP_000421815.1.11000 WP_000421815.1.11024 WP_000421815.1.11031 WP_000421815.1.11041 WP_000421815.1.11098 WP_000421815.1.1110 WP_000421815.1.11119 WP_000421815.1.11156 WP_000421815.1.11168 WP_000421815.1.11190 WP_000421815.1.11213 WP_000421815.1.11216 WP_000421815.1.11295 WP_000421815.1.113 WP_000421815.1.11362 WP_000421815.1.11369 WP_000421815.1.1137 WP_000421815.1.11405 WP_000421815.1.11455 WP_000421815.1.11479 WP_000421815.1.1150 WP_000421815.1.11511 WP_000421815.1.11518 WP_000421815.1.11528 WP_000421815.1.11532 WP_000421815.1.11543 WP_000421815.1.11544 WP_000421815.1.1156 WP_000421815.1.11565 WP_000421815.1.11588 WP_000421815.1.11603 WP_000421815.1.11621 WP_000421815.1.11677 WP_000421815.1.11687 WP_000421815.1.11735 WP_000421815.1.11763 WP_000421815.1.11772 WP_000421815.1.11834 WP_000421815.1.11865 WP_000421815.1.11868 WP_000421815.1.11897 WP_000421815.1.11900 WP_000421815.1.11936 WP_000421815.1.11964 WP_000421815.1.11978 WP_000421815.1.12007 WP_000421815.1.12025 WP_000421815.1.12027 WP_000421815.1.12059 WP_000421815.1.12063 WP_000421815.1.12114 WP_000421815.1.12144 WP_000421815.1.1215 WP_000421815.1.12159 WP_000421815.1.12160 WP_000421815.1.12244 WP_000421815.1.12280 WP_000421815.1.12282 WP_000421815.1.12351 WP_000421815.1.1239 WP_000421815.1.12396 WP_000421815.1.1246 WP_000421815.1.12472 WP_000421815.1.12484 WP_000421815.1.12546 WP_000421815.1.12568 WP_000421815.1.12584 WP_000421815.1.1264 WP_000421815.1.12650 WP_000421815.1.12696 WP_000421815.1.12701 WP_000421815.1.12718 WP_000421815.1.12728 WP_000421815.1.12864 WP_000421815.1.12877 WP_000421815.1.12879 WP_000421815.1.12936 WP_000421815.1.1299 WP_000421815.1.12995 WP_000421815.1.1300 WP_000421815.1.13027 WP_000421815.1.13101 WP_000421815.1.13102 WP_000421815.1.13106 WP_000421815.1.13130 WP_000421815.1.13207 WP_000421815.1.13274 WP_000421815.1.13311 WP_000421815.1.13334 WP_000421815.1.13391 WP_000421815.1.13414 WP_000421815.1.13429 WP_000421815.1.13446 WP_000421815.1.1346 WP_000421815.1.13488 WP_000421815.1.13509 WP_000421815.1.13528 WP_000421815.1.13543 WP_000421815.1.13625 WP_000421815.1.13661 WP_000421815.1.13669 WP_000421815.1.13691 WP_000421815.1.13741 WP_000421815.1.13764 WP_000421815.1.13799 WP_000421815.1.13819 WP_000421815.1.13827 WP_000421815.1.13829 WP_000421815.1.13848 WP_000421815.1.13857 WP_000421815.1.13908 WP_000421815.1.13968 WP_000421815.1.14001 WP_000421815.1.14011 WP_000421815.1.14041 WP_000421815.1.14050 WP_000421815.1.14056 WP_000421815.1.14111 WP_000421815.1.1412 WP_000421815.1.14151 WP_000421815.1.14212 WP_000421815.1.14239 WP_000421815.1.14286 WP_000421815.1.14296 WP_000421815.1.14320 WP_000421815.1.14369 WP_000421815.1.14379 WP_000421815.1.1440 WP_000421815.1.14406 WP_000421815.1.14410 WP_000421815.1.14436 WP_000421815.1.14446 WP_000421815.1.14458 WP_000421815.1.14466 WP_000421815.1.14505 WP_000421815.1.14516 WP_000421815.1.14519 WP_000421815.1.14528 WP_000421815.1.14554 WP_000421815.1.14618 WP_000421815.1.14706 WP_000421815.1.14725 WP_000421815.1.14737 WP_000421815.1.14793 WP_000421815.1.14808 WP_000421815.1.14852 WP_000421815.1.14876 WP_000421815.1.14884 WP_000421815.1.1489 WP_000421815.1.14927 WP_000421815.1.14932 WP_000421815.1.14936 WP_000421815.1.14964 WP_000421815.1.15046 WP_000421815.1.15054 WP_000421815.1.15055 WP_000421815.1.15100 WP_000421815.1.15124 WP_000421815.1.15214 WP_000421815.1.15223 WP_000421815.1.15226 WP_000421815.1.15276 WP_000421815.1.15316 WP_000421815.1.15353 WP_000421815.1.15369 WP_000421815.1.1540 WP_000421815.1.15479 WP_000421815.1.15508 WP_000421815.1.1551 WP_000421815.1.15585 WP_000421815.1.15586 WP_000421815.1.15616 WP_000421815.1.15627 WP_000421815.1.15644 WP_000421815.1.15775 WP_000421815.1.15784 WP_000421815.1.15795 WP_000421815.1.15830 WP_000421815.1.15835 WP_000421815.1.15862 WP_000421815.1.15881 WP_000421815.1.15910 WP_000421815.1.1592 WP_000421815.1.15978 WP_000421815.1.15986 WP_000421815.1.15995 WP_000421815.1.16000 WP_000421815.1.16004 WP_000421815.1.16006 WP_000421815.1.16028 WP_000421815.1.16047 WP_000421815.1.16052 WP_000421815.1.16062 WP_000421815.1.16063 WP_000421815.1.16103 WP_000421815.1.1611 WP_000421815.1.16158 WP_000421815.1.16166 WP_000421815.1.16201 WP_000421815.1.16226 WP_000421815.1.16233 WP_000421815.1.16273 WP_000421815.1.16284 WP_000421815.1.1635 WP_000421815.1.16361 WP_000421815.1.16363 WP_000421815.1.16366 WP_000421815.1.16394 WP_000421815.1.16453 WP_000421815.1.16468 WP_000421815.1.16474 WP_000421815.1.16525 WP_000421815.1.16551 WP_000421815.1.16565 WP_000421815.1.16581 WP_000421815.1.16614 WP_000421815.1.16650 WP_000421815.1.16656 WP_000421815.1.16686 WP_000421815.1.16691 WP_000421815.1.167 WP_000421815.1.16732 WP_000421815.1.16735 WP_000421815.1.16736 WP_000421815.1.16786 WP_000421815.1.16804 WP_000421815.1.16819 WP_000421815.1.16826 WP_000421815.1.16846 WP_000421815.1.16855 WP_000421815.1.16858 WP_000421815.1.16873 WP_000421815.1.16896 WP_000421815.1.16903 WP_000421815.1.16916 WP_000421815.1.16942 WP_000421815.1.16944 WP_000421815.1.16949 WP_000421815.1.16965 WP_000421815.1.16998 WP_000421815.1.1700 WP_000421815.1.17031 WP_000421815.1.17060 WP_000421815.1.17093 WP_000421815.1.17188 WP_000421815.1.17270 WP_000421815.1.17307 WP_000421815.1.1737 WP_000421815.1.17390 WP_000421815.1.174 WP_000421815.1.17439 WP_000421815.1.17480 WP_000421815.1.1749 WP_000421815.1.17504 WP_000421815.1.17525 WP_000421815.1.17546 WP_000421815.1.17560 WP_000421815.1.1757 WP_000421815.1.17583 WP_000421815.1.17629 WP_000421815.1.17702 WP_000421815.1.17703 WP_000421815.1.17705 WP_000421815.1.17743 WP_000421815.1.17865 WP_000421815.1.17886 WP_000421815.1.17901 WP_000421815.1.17936 WP_000421815.1.17949 WP_000421815.1.1798 WP_000421815.1.18019 WP_000421815.1.18022 WP_000421815.1.18056 WP_000421815.1.1807 WP_000421815.1.18092 WP_000421815.1.18111 WP_000421815.1.18122 WP_000421815.1.1814 WP_000421815.1.18149 WP_000421815.1.18163 WP_000421815.1.18177 WP_000421815.1.18178 WP_000421815.1.1818 WP_000421815.1.18192 WP_000421815.1.1825 WP_000421815.1.18254 WP_000421815.1.18265 WP_000421815.1.18267 WP_000421815.1.18277 WP_000421815.1.18281 WP_000421815.1.18282 WP_000421815.1.18365 WP_000421815.1.18384 WP_000421815.1.18426 WP_000421815.1.18441 WP_000421815.1.18445 WP_000421815.1.18468 WP_000421815.1.18485 WP_000421815.1.18489 WP_000421815.1.18607 WP_000421815.1.18641 WP_000421815.1.18686 WP_000421815.1.18692 WP_000421815.1.18705 WP_000421815.1.18715 WP_000421815.1.18737 WP_000421815.1.18776 WP_000421815.1.18822 WP_000421815.1.18847 WP_000421815.1.18881 WP_000421815.1.18886 WP_000421815.1.18895 WP_000421815.1.18919 WP_000421815.1.18940 WP_000421815.1.18949 WP_000421815.1.19030 WP_000421815.1.19053 WP_000421815.1.19064 WP_000421815.1.19163 WP_000421815.1.19174 WP_000421815.1.19273 WP_000421815.1.19291 WP_000421815.1.19340 WP_000421815.1.19357 WP_000421815.1.19405 WP_000421815.1.19458 WP_000421815.1.19460 WP_000421815.1.19461 WP_000421815.1.19469 WP_000421815.1.1954 WP_000421815.1.19588 WP_000421815.1.19614 WP_000421815.1.19616 WP_000421815.1.19642 WP_000421815.1.19660 WP_000421815.1.1968 WP_000421815.1.19702 WP_000421815.1.19706 WP_000421815.1.19723 WP_000421815.1.19724 WP_000421815.1.19740 WP_000421815.1.19749 WP_000421815.1.19784 WP_000421815.1.19793 WP_000421815.1.19802 WP_000421815.1.19809 WP_000421815.1.19823 WP_000421815.1.19851 WP_000421815.1.19863 WP_000421815.1.19867 WP_000421815.1.19884 WP_000421815.1.19938 WP_000421815.1.19970 WP_000421815.1.19975 WP_000421815.1.1998 WP_000421815.1.20 WP_000421815.1.20023 WP_000421815.1.20034 WP_000421815.1.20081 WP_000421815.1.20089 WP_000421815.1.20091 WP_000421815.1.2010 WP_000421815.1.20119 WP_000421815.1.20212 WP_000421815.1.20218 WP_000421815.1.2026 WP_000421815.1.20266 WP_000421815.1.20271 WP_000421815.1.20330 WP_000421815.1.20362 WP_000421815.1.20364 WP_000421815.1.20376 WP_000421815.1.2041 WP_000421815.1.20415 WP_000421815.1.20418 WP_000421815.1.20443 WP_000421815.1.20446 WP_000421815.1.2047 WP_000421815.1.20488 WP_000421815.1.20525 WP_000421815.1.2054 WP_000421815.1.20553 WP_000421815.1.20573 WP_000421815.1.20614 WP_000421815.1.20626 WP_000421815.1.20631 WP_000421815.1.20646 WP_000421815.1.20721 WP_000421815.1.20760 WP_000421815.1.20767 WP_000421815.1.20787 WP_000421815.1.20795 WP_000421815.1.20810 WP_000421815.1.20839 WP_000421815.1.20862 WP_000421815.1.20886 WP_000421815.1.20900 WP_000421815.1.20908 WP_000421815.1.2101 WP_000421815.1.21049 WP_000421815.1.21075 WP_000421815.1.21079 WP_000421815.1.21086 WP_000421815.1.21089 WP_000421815.1.21103 WP_000421815.1.21136 WP_000421815.1.21146 WP_000421815.1.2116 WP_000421815.1.21165 WP_000421815.1.21181 WP_000421815.1.21245 WP_000421815.1.21246 WP_000421815.1.21260 WP_000421815.1.21269 WP_000421815.1.21286 WP_000421815.1.21309 WP_000421815.1.21326 WP_000421815.1.21351 WP_000421815.1.21362 WP_000421815.1.21399 WP_000421815.1.21400 WP_000421815.1.21404 WP_000421815.1.21423 WP_000421815.1.21443 WP_000421815.1.21453 WP_000421815.1.2146 WP_000421815.1.21473 WP_000421815.1.21497 WP_000421815.1.21499 WP_000421815.1.21548 WP_000421815.1.21603 WP_000421815.1.21616 WP_000421815.1.21681 WP_000421815.1.21692 WP_000421815.1.21730 WP_000421815.1.21751 WP_000421815.1.21757 WP_000421815.1.21845 WP_000421815.1.21877 WP_000421815.1.21910 WP_000421815.1.21940 WP_000421815.1.21950 WP_000421815.1.21981 WP_000421815.1.21991 WP_000421815.1.22019 WP_000421815.1.22024 WP_000421815.1.22030 WP_000421815.1.2205 WP_000421815.1.22051 WP_000421815.1.22062 WP_000421815.1.22067 WP_000421815.1.22069 WP_000421815.1.22096 WP_000421815.1.22117 WP_000421815.1.22136 WP_000421815.1.22158 WP_000421815.1.22205 WP_000421815.1.2221 WP_000421815.1.22235 WP_000421815.1.2224 WP_000421815.1.22240 WP_000421815.1.22296 WP_000421815.1.22315 WP_000421815.1.22323 WP_000421815.1.22337 WP_000421815.1.22346 WP_000421815.1.2235 WP_000421815.1.22379 WP_000421815.1.22427 WP_000421815.1.22449 WP_000421815.1.22453 WP_000421815.1.2246 WP_000421815.1.22460 WP_000421815.1.22485 WP_000421815.1.22537 WP_000421815.1.22565 WP_000421815.1.22575 WP_000421815.1.22582 WP_000421815.1.22590 WP_000421815.1.22595 WP_000421815.1.22604 WP_000421815.1.22620 WP_000421815.1.22623 WP_000421815.1.22676 WP_000421815.1.22692 WP_000421815.1.22758 WP_000421815.1.22760 WP_000421815.1.2283 WP_000421815.1.22855 WP_000421815.1.22864 WP_000421815.1.22870 WP_000421815.1.22966 WP_000421815.1.22979 WP_000421815.1.23010 WP_000421815.1.23053 WP_000421815.1.23080 WP_000421815.1.23102 WP_000421815.1.23114 WP_000421815.1.2314 WP_000421815.1.23155 WP_000421815.1.23169 WP_000421815.1.23172 WP_000421815.1.23175 WP_000421815.1.23192 WP_000421815.1.2324 WP_000421815.1.23246 WP_000421815.1.23258 WP_000421815.1.23259 WP_000421815.1.23279 WP_000421815.1.23311 WP_000421815.1.23329 WP_000421815.1.23343 WP_000421815.1.23379 WP_000421815.1.23409 WP_000421815.1.2342 WP_000421815.1.23442 WP_000421815.1.23444 WP_000421815.1.23460 WP_000421815.1.23466 WP_000421815.1.23472 WP_000421815.1.23482 WP_000421815.1.23485 WP_000421815.1.235 WP_000421815.1.23500 WP_000421815.1.23503 WP_000421815.1.23509 WP_000421815.1.23529 WP_000421815.1.2358 WP_000421815.1.23587 WP_000421815.1.23621 WP_000421815.1.23629 WP_000421815.1.23634 WP_000421815.1.23639 WP_000421815.1.2364 WP_000421815.1.23643 WP_000421815.1.23646 WP_000421815.1.23675 WP_000421815.1.23685 WP_000421815.1.237 WP_000421815.1.23707 WP_000421815.1.23720 WP_000421815.1.23755 WP_000421815.1.2380 WP_000421815.1.23932 WP_000421815.1.23959 WP_000421815.1.24017 WP_000421815.1.24082 WP_000421815.1.24145 WP_000421815.1.24158 WP_000421815.1.24206 WP_000421815.1.24259 WP_000421815.1.24297 WP_000421815.1.24303 WP_000421815.1.24308 WP_000421815.1.24325 WP_000421815.1.24376 WP_000421815.1.24408 WP_000421815.1.24412 WP_000421815.1.24419 WP_000421815.1.24450 WP_000421815.1.24494 WP_000421815.1.24521 WP_000421815.1.24555 WP_000421815.1.24578 WP_000421815.1.2467 WP_000421815.1.24686 WP_000421815.1.24696 WP_000421815.1.24723 WP_000421815.1.24727 WP_000421815.1.24737 WP_000421815.1.24779 WP_000421815.1.24803 WP_000421815.1.24837 WP_000421815.1.24839 WP_000421815.1.24873 WP_000421815.1.24901 WP_000421815.1.24995 WP_000421815.1.25008 WP_000421815.1.25015 WP_000421815.1.25036 WP_000421815.1.25064 WP_000421815.1.25119 WP_000421815.1.25159 WP_000421815.1.25205 WP_000421815.1.25206 WP_000421815.1.25217 WP_000421815.1.25229 WP_000421815.1.25397 WP_000421815.1.25405 WP_000421815.1.25421 WP_000421815.1.25426 WP_000421815.1.25454 WP_000421815.1.25493 WP_000421815.1.25514 WP_000421815.1.25546 WP_000421815.1.25564 WP_000421815.1.25596 WP_000421815.1.25668 WP_000421815.1.2568 WP_000421815.1.25690 WP_000421815.1.2570 WP_000421815.1.25703 WP_000421815.1.25708 WP_000421815.1.25709 WP_000421815.1.25740 WP_000421815.1.25780 WP_000421815.1.25809 WP_000421815.1.2581 WP_000421815.1.25814 WP_000421815.1.25825 WP_000421815.1.25928 WP_000421815.1.25951 WP_000421815.1.25988 WP_000421815.1.26030 WP_000421815.1.26034 WP_000421815.1.26075 WP_000421815.1.26083 WP_000421815.1.26093 WP_000421815.1.26123 WP_000421815.1.26129 WP_000421815.1.26194 WP_000421815.1.26213 WP_000421815.1.26224 WP_000421815.1.26282 WP_000421815.1.26311 WP_000421815.1.2634 WP_000421815.1.26384 WP_000421815.1.26429 WP_000421815.1.26440 WP_000421815.1.26441 WP_000421815.1.26493 WP_000421815.1.26512 WP_000421815.1.26532 WP_000421815.1.26551 WP_000421815.1.26567 WP_000421815.1.26582 WP_000421815.1.26587 WP_000421815.1.2660 WP_000421815.1.26646 WP_000421815.1.2667 WP_000421815.1.26687 WP_000421815.1.26709 WP_000421815.1.26741 WP_000421815.1.26794 WP_000421815.1.26833 WP_000421815.1.26856 WP_000421815.1.26882 WP_000421815.1.26883 WP_000421815.1.26892 WP_000421815.1.26919 WP_000421815.1.26924 WP_000421815.1.26936 WP_000421815.1.27051 WP_000421815.1.27055 WP_000421815.1.27072 WP_000421815.1.27084 WP_000421815.1.27169 WP_000421815.1.27173 WP_000421815.1.272 WP_000421815.1.27206 WP_000421815.1.27223 WP_000421815.1.2723 WP_000421815.1.27272 WP_000421815.1.27279 WP_000421815.1.27314 WP_000421815.1.27383 WP_000421815.1.27423 WP_000421815.1.27535 WP_000421815.1.27544 WP_000421815.1.27556 WP_000421815.1.27561 WP_000421815.1.2763 WP_000421815.1.27632 WP_000421815.1.27638 WP_000421815.1.27655 WP_000421815.1.27658 WP_000421815.1.27665 WP_000421815.1.27679 WP_000421815.1.27707 WP_000421815.1.27713 WP_000421815.1.27761 WP_000421815.1.2777 WP_000421815.1.27776 WP_000421815.1.27798 WP_000421815.1.27800 WP_000421815.1.27857 WP_000421815.1.27883 WP_000421815.1.27969 WP_000421815.1.27977 WP_000421815.1.27995 WP_000421815.1.27997 WP_000421815.1.28002 WP_000421815.1.28037 WP_000421815.1.28056 WP_000421815.1.2806 WP_000421815.1.28073 WP_000421815.1.28094 WP_000421815.1.28116 WP_000421815.1.28126 WP_000421815.1.28170 WP_000421815.1.28174 WP_000421815.1.28200 WP_000421815.1.28225 WP_000421815.1.28232 WP_000421815.1.28233 WP_000421815.1.28235 WP_000421815.1.28267 WP_000421815.1.2829 WP_000421815.1.28302 WP_000421815.1.28303 WP_000421815.1.2835 WP_000421815.1.28370 WP_000421815.1.28393 WP_000421815.1.28462 WP_000421815.1.28504 WP_000421815.1.2853 WP_000421815.1.28538 WP_000421815.1.28575 WP_000421815.1.28620 WP_000421815.1.28625 WP_000421815.1.28655 WP_000421815.1.28673 WP_000421815.1.28694 WP_000421815.1.28733 WP_000421815.1.28775 WP_000421815.1.28776 WP_000421815.1.2879 WP_000421815.1.28811 WP_000421815.1.28830 WP_000421815.1.2890 WP_000421815.1.28902 WP_000421815.1.28946 WP_000421815.1.28948 WP_000421815.1.28963 WP_000421815.1.28977 WP_000421815.1.29006 WP_000421815.1.29010 WP_000421815.1.29099 WP_000421815.1.2910 WP_000421815.1.29113 WP_000421815.1.29130 WP_000421815.1.29190 WP_000421815.1.29218 WP_000421815.1.2924 WP_000421815.1.29255 WP_000421815.1.29265 WP_000421815.1.29274 WP_000421815.1.29349 WP_000421815.1.29422 WP_000421815.1.29436 WP_000421815.1.29454 WP_000421815.1.29509 WP_000421815.1.29530 WP_000421815.1.29576 WP_000421815.1.29588 WP_000421815.1.29601 WP_000421815.1.29606 WP_000421815.1.29615 WP_000421815.1.29682 WP_000421815.1.29704 WP_000421815.1.29711 WP_000421815.1.29732 WP_000421815.1.29768 WP_000421815.1.29774 WP_000421815.1.29827 WP_000421815.1.2984 WP_000421815.1.29845 WP_000421815.1.29898 WP_000421815.1.29969 WP_000421815.1.29990 WP_000421815.1.30006 WP_000421815.1.30018 WP_000421815.1.30022 WP_000421815.1.30027 WP_000421815.1.30086 WP_000421815.1.30093 WP_000421815.1.30170 WP_000421815.1.30179 WP_000421815.1.30195 WP_000421815.1.30202 WP_000421815.1.30210 WP_000421815.1.30213 WP_000421815.1.30225 WP_000421815.1.30246 WP_000421815.1.30278 WP_000421815.1.30331 WP_000421815.1.30389 WP_000421815.1.30425 WP_000421815.1.30469 WP_000421815.1.30505 WP_000421815.1.30507 WP_000421815.1.30535 WP_000421815.1.30547 WP_000421815.1.30573 WP_000421815.1.30589 WP_000421815.1.3066 WP_000421815.1.3067 WP_000421815.1.3068 WP_000421815.1.30696 WP_000421815.1.3076 WP_000421815.1.30794 WP_000421815.1.30802 WP_000421815.1.30819 WP_000421815.1.30823 WP_000421815.1.30833 WP_000421815.1.30835 WP_000421815.1.3089 WP_000421815.1.30934 WP_000421815.1.3095 WP_000421815.1.30972 WP_000421815.1.31 WP_000421815.1.31001 WP_000421815.1.31011 WP_000421815.1.31042 WP_000421815.1.31086 WP_000421815.1.31092 WP_000421815.1.31107 WP_000421815.1.31122 WP_000421815.1.3113 WP_000421815.1.3114 WP_000421815.1.31155 WP_000421815.1.31171 WP_000421815.1.31185 WP_000421815.1.3119 WP_000421815.1.31190 WP_000421815.1.31196 WP_000421815.1.31214 WP_000421815.1.31219 WP_000421815.1.31222 WP_000421815.1.31262 WP_000421815.1.31281 WP_000421815.1.31362 WP_000421815.1.31435 WP_000421815.1.31451 WP_000421815.1.31504 WP_000421815.1.31515 WP_000421815.1.31578 WP_000421815.1.31658 WP_000421815.1.31665 WP_000421815.1.3170 WP_000421815.1.31762 WP_000421815.1.31782 WP_000421815.1.31854 WP_000421815.1.31895 WP_000421815.1.31927 WP_000421815.1.31940 WP_000421815.1.31952 WP_000421815.1.31967 WP_000421815.1.31972 WP_000421815.1.31983 WP_000421815.1.32006 WP_000421815.1.32038 WP_000421815.1.32054 WP_000421815.1.32056 WP_000421815.1.32109 WP_000421815.1.32116 WP_000421815.1.32170 WP_000421815.1.32192 WP_000421815.1.32204 WP_000421815.1.32206 WP_000421815.1.32255 WP_000421815.1.32260 WP_000421815.1.32275 WP_000421815.1.32357 WP_000421815.1.32368 WP_000421815.1.32408 WP_000421815.1.32423 WP_000421815.1.32424 WP_000421815.1.32434 WP_000421815.1.32438 WP_000421815.1.32459 WP_000421815.1.32491 WP_000421815.1.32515 WP_000421815.1.32527 WP_000421815.1.32545 WP_000421815.1.32629 WP_000421815.1.32643 WP_000421815.1.32660 WP_000421815.1.32668 WP_000421815.1.32702 WP_000421815.1.32714 WP_000421815.1.32740 WP_000421815.1.32747 WP_000421815.1.32750 WP_000421815.1.3278 WP_000421815.1.32786 WP_000421815.1.32804 WP_000421815.1.32860 WP_000421815.1.32907 WP_000421815.1.32930 WP_000421815.1.32977 WP_000421815.1.33030 WP_000421815.1.3304 WP_000421815.1.33078 WP_000421815.1.33106 WP_000421815.1.33127 WP_000421815.1.33143 WP_000421815.1.33144 WP_000421815.1.33248 WP_000421815.1.33261 WP_000421815.1.33270 WP_000421815.1.333 WP_000421815.1.33392 WP_000421815.1.33486 WP_000421815.1.33492 WP_000421815.1.335 WP_000421815.1.33553 WP_000421815.1.3356 WP_000421815.1.33580 WP_000421815.1.33592 WP_000421815.1.33609 WP_000421815.1.33629 WP_000421815.1.3364 WP_000421815.1.33693 WP_000421815.1.33817 WP_000421815.1.33865 WP_000421815.1.33894 WP_000421815.1.3394 WP_000421815.1.3395 WP_000421815.1.34022 WP_000421815.1.34043 WP_000421815.1.34075 WP_000421815.1.34081 WP_000421815.1.34084 WP_000421815.1.34091 WP_000421815.1.34126 WP_000421815.1.34179 WP_000421815.1.34257 WP_000421815.1.34279 WP_000421815.1.34292 WP_000421815.1.34304 WP_000421815.1.34319 WP_000421815.1.34330 WP_000421815.1.3438 WP_000421815.1.34417 WP_000421815.1.34453 WP_000421815.1.34458 WP_000421815.1.34496 WP_000421815.1.34610 WP_000421815.1.34614 WP_000421815.1.34647 WP_000421815.1.34667 WP_000421815.1.34684 WP_000421815.1.34703 WP_000421815.1.34704 WP_000421815.1.34707 WP_000421815.1.34711 WP_000421815.1.34745 WP_000421815.1.34854 WP_000421815.1.34856 WP_000421815.1.34881 WP_000421815.1.34972 WP_000421815.1.34975 WP_000421815.1.34977 WP_000421815.1.35035 WP_000421815.1.35045 WP_000421815.1.35075 WP_000421815.1.35125 WP_000421815.1.35129 WP_000421815.1.35184 WP_000421815.1.35193 WP_000421815.1.35294 WP_000421815.1.35298 WP_000421815.1.35321 WP_000421815.1.35332 WP_000421815.1.35404 WP_000421815.1.35408 WP_000421815.1.3541 WP_000421815.1.35425 WP_000421815.1.35429 WP_000421815.1.35446 WP_000421815.1.35460 WP_000421815.1.35494 WP_000421815.1.35503 WP_000421815.1.35509 WP_000421815.1.3556 WP_000421815.1.35570 WP_000421815.1.35590 WP_000421815.1.35619 WP_000421815.1.35624 WP_000421815.1.3566 WP_000421815.1.3572 WP_000421815.1.35835 WP_000421815.1.35868 WP_000421815.1.35892 WP_000421815.1.35936 WP_000421815.1.35940 WP_000421815.1.35961 WP_000421815.1.35993 WP_000421815.1.36003 WP_000421815.1.3601 WP_000421815.1.36011 WP_000421815.1.36017 WP_000421815.1.36063 WP_000421815.1.3610 WP_000421815.1.36229 WP_000421815.1.36232 WP_000421815.1.36236 WP_000421815.1.36286 WP_000421815.1.36425 WP_000421815.1.36445 WP_000421815.1.36512 WP_000421815.1.36547 WP_000421815.1.36564 WP_000421815.1.36584 WP_000421815.1.36592 WP_000421815.1.36609 WP_000421815.1.36690 WP_000421815.1.3670 WP_000421815.1.36705 WP_000421815.1.36721 WP_000421815.1.36764 WP_000421815.1.36765 WP_000421815.1.36792 WP_000421815.1.36839 WP_000421815.1.3688 WP_000421815.1.36885 WP_000421815.1.36899 WP_000421815.1.36918 WP_000421815.1.36931 WP_000421815.1.36949 WP_000421815.1.37021 WP_000421815.1.37029 WP_000421815.1.37063 WP_000421815.1.37073 WP_000421815.1.37100 WP_000421815.1.37111 WP_000421815.1.37112 WP_000421815.1.37147 WP_000421815.1.37256 WP_000421815.1.3726 WP_000421815.1.37267 WP_000421815.1.3728 WP_000421815.1.37293 WP_000421815.1.37297 WP_000421815.1.3734 WP_000421815.1.37351 WP_000421815.1.37363 WP_000421815.1.37370 WP_000421815.1.37376 WP_000421815.1.3744 WP_000421815.1.37478 WP_000421815.1.3748 WP_000421815.1.37498 WP_000421815.1.37504 WP_000421815.1.3751 WP_000421815.1.37521 WP_000421815.1.37610 WP_000421815.1.37618 WP_000421815.1.37687 WP_000421815.1.3771 WP_000421815.1.37719 WP_000421815.1.37848 WP_000421815.1.37864 WP_000421815.1.37965 WP_000421815.1.37968 WP_000421815.1.38001 WP_000421815.1.38026 WP_000421815.1.38037 WP_000421815.1.38047 WP_000421815.1.38055 WP_000421815.1.38113 WP_000421815.1.38125 WP_000421815.1.38145 WP_000421815.1.38273 WP_000421815.1.3828 WP_000421815.1.383 WP_000421815.1.38322 WP_000421815.1.38341 WP_000421815.1.38349 WP_000421815.1.38393 WP_000421815.1.38512 WP_000421815.1.38569 WP_000421815.1.38609 WP_000421815.1.38613 WP_000421815.1.38622 WP_000421815.1.38673 WP_000421815.1.3869 WP_000421815.1.38693 WP_000421815.1.38773 WP_000421815.1.38781 WP_000421815.1.38797 WP_000421815.1.38830 WP_000421815.1.38857 WP_000421815.1.38882 WP_000421815.1.38898 WP_000421815.1.38913 WP_000421815.1.38942 WP_000421815.1.38995 WP_000421815.1.39003 WP_000421815.1.39038 WP_000421815.1.39055 WP_000421815.1.39059 WP_000421815.1.39065 WP_000421815.1.39075 WP_000421815.1.39082 WP_000421815.1.39128 WP_000421815.1.39136 WP_000421815.1.39183 WP_000421815.1.39197 WP_000421815.1.39229 WP_000421815.1.39265 WP_000421815.1.39275 WP_000421815.1.39311 WP_000421815.1.39312 WP_000421815.1.39385 WP_000421815.1.39395 WP_000421815.1.39405 WP_000421815.1.39414 WP_000421815.1.39420 WP_000421815.1.39449 WP_000421815.1.39466 WP_000421815.1.39497 WP_000421815.1.39503 WP_000421815.1.39512 WP_000421815.1.39556 WP_000421815.1.39584 WP_000421815.1.39609 WP_000421815.1.39614 WP_000421815.1.39629 WP_000421815.1.39722 WP_000421815.1.39723 WP_000421815.1.39724 WP_000421815.1.39763 WP_000421815.1.39808 WP_000421815.1.39862 WP_000421815.1.39923 WP_000421815.1.40008 WP_000421815.1.40017 WP_000421815.1.40025 WP_000421815.1.40072 WP_000421815.1.40073 WP_000421815.1.40081 WP_000421815.1.4011 WP_000421815.1.40111 WP_000421815.1.40155 WP_000421815.1.40158 WP_000421815.1.40170 WP_000421815.1.40171 WP_000421815.1.40205 WP_000421815.1.40208 WP_000421815.1.40224 WP_000421815.1.40229 WP_000421815.1.40240 WP_000421815.1.40254 WP_000421815.1.40257 WP_000421815.1.40258 WP_000421815.1.40259 WP_000421815.1.40292 WP_000421815.1.40305 WP_000421815.1.40307 WP_000421815.1.40311 WP_000421815.1.40341 WP_000421815.1.40374 WP_000421815.1.40380 WP_000421815.1.40395 WP_000421815.1.40465 WP_000421815.1.40508 WP_000421815.1.40528 WP_000421815.1.40533 WP_000421815.1.40577 WP_000421815.1.40583 WP_000421815.1.40605 WP_000421815.1.40622 WP_000421815.1.40693 WP_000421815.1.40695 WP_000421815.1.40710 WP_000421815.1.40722 WP_000421815.1.40745 WP_000421815.1.4075 WP_000421815.1.40771 WP_000421815.1.4087 WP_000421815.1.40877 WP_000421815.1.4088 WP_000421815.1.40910 WP_000421815.1.40930 WP_000421815.1.40935 WP_000421815.1.40996 WP_000421815.1.41017 WP_000421815.1.41018 WP_000421815.1.41048 WP_000421815.1.41050 WP_000421815.1.41086 WP_000421815.1.4109 WP_000421815.1.41091 WP_000421815.1.41116 WP_000421815.1.41128 WP_000421815.1.41192 WP_000421815.1.41225 WP_000421815.1.41226 WP_000421815.1.41265 WP_000421815.1.41277 WP_000421815.1.41279 WP_000421815.1.41299 WP_000421815.1.41308 WP_000421815.1.41310 WP_000421815.1.41375 WP_000421815.1.4141 WP_000421815.1.41427 WP_000421815.1.41434 WP_000421815.1.41438 WP_000421815.1.41440 WP_000421815.1.41468 WP_000421815.1.41516 WP_000421815.1.41528 WP_000421815.1.41554 WP_000421815.1.41572 WP_000421815.1.41591 WP_000421815.1.41593 WP_000421815.1.41628 WP_000421815.1.41662 WP_000421815.1.41688 WP_000421815.1.41690 WP_000421815.1.41708 WP_000421815.1.41724 WP_000421815.1.41735 WP_000421815.1.41761 WP_000421815.1.4178 WP_000421815.1.41802 WP_000421815.1.4184 WP_000421815.1.41859 WP_000421815.1.41862 WP_000421815.1.41877 WP_000421815.1.41882 WP_000421815.1.41897 WP_000421815.1.41904 WP_000421815.1.41931 WP_000421815.1.41938 WP_000421815.1.41979 WP_000421815.1.41985 WP_000421815.1.41994 WP_000421815.1.41998 WP_000421815.1.42104 WP_000421815.1.42109 WP_000421815.1.42156 WP_000421815.1.422 WP_000421815.1.4222 WP_000421815.1.42243 WP_000421815.1.42244 WP_000421815.1.42276 WP_000421815.1.42320 WP_000421815.1.42328 WP_000421815.1.42342 WP_000421815.1.42356 WP_000421815.1.42422 WP_000421815.1.42433 WP_000421815.1.42444 WP_000421815.1.42453 WP_000421815.1.42489 WP_000421815.1.42491 WP_000421815.1.4257 WP_000421815.1.42595 WP_000421815.1.42655 WP_000421815.1.42666 WP_000421815.1.42675 WP_000421815.1.42676 WP_000421815.1.42683 WP_000421815.1.42685 WP_000421815.1.42734 WP_000421815.1.4276 WP_000421815.1.42767 WP_000421815.1.42794 WP_000421815.1.42861 WP_000421815.1.42864 WP_000421815.1.4288 WP_000421815.1.42892 WP_000421815.1.42957 WP_000421815.1.42981 WP_000421815.1.43018 WP_000421815.1.43041 WP_000421815.1.43077 WP_000421815.1.43086 WP_000421815.1.43089 WP_000421815.1.43126 WP_000421815.1.43149 WP_000421815.1.43160 WP_000421815.1.43201 WP_000421815.1.43244 WP_000421815.1.43272 WP_000421815.1.43276 WP_000421815.1.43299 WP_000421815.1.43312 WP_000421815.1.4332 WP_000421815.1.43334 WP_000421815.1.43339 WP_000421815.1.43351 WP_000421815.1.43371 WP_000421815.1.43437 WP_000421815.1.4344 WP_000421815.1.43441 WP_000421815.1.43476 WP_000421815.1.43520 WP_000421815.1.43522 WP_000421815.1.43606 WP_000421815.1.43613 WP_000421815.1.43654 WP_000421815.1.43676 WP_000421815.1.43711 WP_000421815.1.4373 WP_000421815.1.43763 WP_000421815.1.43778 WP_000421815.1.43785 WP_000421815.1.43828 WP_000421815.1.43839 WP_000421815.1.43864 WP_000421815.1.43873 WP_000421815.1.43886 WP_000421815.1.43951 WP_000421815.1.44005 WP_000421815.1.44010 WP_000421815.1.4404 WP_000421815.1.44043 WP_000421815.1.44063 WP_000421815.1.44099 WP_000421815.1.44113 WP_000421815.1.44121 WP_000421815.1.44187 WP_000421815.1.44191 WP_000421815.1.4422 WP_000421815.1.4423 WP_000421815.1.44300 WP_000421815.1.44310 WP_000421815.1.44337 WP_000421815.1.44339 WP_000421815.1.44359 WP_000421815.1.44380 WP_000421815.1.44386 WP_000421815.1.44397 WP_000421815.1.44433 WP_000421815.1.44453 WP_000421815.1.44479 WP_000421815.1.44549 WP_000421815.1.44578 WP_000421815.1.44607 WP_000421815.1.44636 WP_000421815.1.44640 WP_000421815.1.4467 WP_000421815.1.44705 WP_000421815.1.44747 WP_000421815.1.44781 WP_000421815.1.44791 WP_000421815.1.44795 WP_000421815.1.44831 WP_000421815.1.4485 WP_000421815.1.44877 WP_000421815.1.44887 WP_000421815.1.449 WP_000421815.1.44927 WP_000421815.1.44933 WP_000421815.1.44966 WP_000421815.1.44971 WP_000421815.1.44978 WP_000421815.1.44985 WP_000421815.1.44997 WP_000421815.1.44998 WP_000421815.1.4500 WP_000421815.1.45038 WP_000421815.1.45045 WP_000421815.1.45067 WP_000421815.1.45074 WP_000421815.1.45079 WP_000421815.1.45098 WP_000421815.1.45123 WP_000421815.1.45134 WP_000421815.1.45138 WP_000421815.1.45145 WP_000421815.1.45154 WP_000421815.1.45173 WP_000421815.1.45177 WP_000421815.1.45229 WP_000421815.1.45251 WP_000421815.1.45259 WP_000421815.1.45268 WP_000421815.1.45302 WP_000421815.1.4531 WP_000421815.1.45322 WP_000421815.1.45344 WP_000421815.1.45349 WP_000421815.1.45351 WP_000421815.1.45365 WP_000421815.1.4540 WP_000421815.1.45402 WP_000421815.1.45434 WP_000421815.1.45462 WP_000421815.1.45468 WP_000421815.1.45544 WP_000421815.1.45550 WP_000421815.1.45566 WP_000421815.1.45569 WP_000421815.1.45571 WP_000421815.1.45582 WP_000421815.1.45583 WP_000421815.1.45585 WP_000421815.1.45622 WP_000421815.1.45660 WP_000421815.1.45690 WP_000421815.1.45706 WP_000421815.1.45781 WP_000421815.1.45797 WP_000421815.1.458 WP_000421815.1.45848 WP_000421815.1.45906 WP_000421815.1.45918 WP_000421815.1.4592 WP_000421815.1.46011 WP_000421815.1.46028 WP_000421815.1.46069 WP_000421815.1.46091 WP_000421815.1.46173 WP_000421815.1.46174 WP_000421815.1.46187 WP_000421815.1.46205 WP_000421815.1.46243 WP_000421815.1.46278 WP_000421815.1.46286 WP_000421815.1.46299 WP_000421815.1.46303 WP_000421815.1.46323 WP_000421815.1.46345 WP_000421815.1.46358 WP_000421815.1.46434 WP_000421815.1.46572 WP_000421815.1.46574 WP_000421815.1.46595 WP_000421815.1.46620 WP_000421815.1.46637 WP_000421815.1.46666 WP_000421815.1.46675 WP_000421815.1.46689 WP_000421815.1.46726 WP_000421815.1.46803 WP_000421815.1.46804 WP_000421815.1.4686 WP_000421815.1.46930 WP_000421815.1.46976 WP_000421815.1.47005 WP_000421815.1.47008 WP_000421815.1.47014 WP_000421815.1.47057 WP_000421815.1.47067 WP_000421815.1.47214 WP_000421815.1.47257 WP_000421815.1.47389 WP_000421815.1.47429 WP_000421815.1.47448 WP_000421815.1.47460 WP_000421815.1.4747 WP_000421815.1.47472 WP_000421815.1.47478 WP_000421815.1.47482 WP_000421815.1.47492 WP_000421815.1.47506 WP_000421815.1.47507 WP_000421815.1.47567 WP_000421815.1.47579 WP_000421815.1.47587 WP_000421815.1.47614 WP_000421815.1.47621 WP_000421815.1.47649 WP_000421815.1.4769 WP_000421815.1.4770 WP_000421815.1.47767 WP_000421815.1.47799 WP_000421815.1.47814 WP_000421815.1.47850 WP_000421815.1.47875 WP_000421815.1.47902 WP_000421815.1.47911 WP_000421815.1.4795 WP_000421815.1.47992 WP_000421815.1.48124 WP_000421815.1.48132 WP_000421815.1.48209 WP_000421815.1.48215 WP_000421815.1.48218 WP_000421815.1.48242 WP_000421815.1.48244 WP_000421815.1.48247 WP_000421815.1.48253 WP_000421815.1.483 WP_000421815.1.48367 WP_000421815.1.48377 WP_000421815.1.4839 WP_000421815.1.48399 WP_000421815.1.48455 WP_000421815.1.48493 WP_000421815.1.48524 WP_000421815.1.4853 WP_000421815.1.48570 WP_000421815.1.48647 WP_000421815.1.48751 WP_000421815.1.48788 WP_000421815.1.4885 WP_000421815.1.48855 WP_000421815.1.48876 WP_000421815.1.48886 WP_000421815.1.48894 WP_000421815.1.48896 WP_000421815.1.48908 WP_000421815.1.48918 WP_000421815.1.48919 WP_000421815.1.48931 WP_000421815.1.48985 WP_000421815.1.49005 WP_000421815.1.49012 WP_000421815.1.49084 WP_000421815.1.49090 WP_000421815.1.49113 WP_000421815.1.49155 WP_000421815.1.49162 WP_000421815.1.49204 WP_000421815.1.49214 WP_000421815.1.49239 WP_000421815.1.49262 WP_000421815.1.49276 WP_000421815.1.49290 WP_000421815.1.49304 WP_000421815.1.49309 WP_000421815.1.49340 WP_000421815.1.49366 WP_000421815.1.49375 WP_000421815.1.49472 WP_000421815.1.49490 WP_000421815.1.49515 WP_000421815.1.49550 WP_000421815.1.49572 WP_000421815.1.49590 WP_000421815.1.49595 WP_000421815.1.49602 WP_000421815.1.49626 WP_000421815.1.49630 WP_000421815.1.49647 WP_000421815.1.49650 WP_000421815.1.49686 WP_000421815.1.49778 WP_000421815.1.49780 WP_000421815.1.4979 WP_000421815.1.49803 WP_000421815.1.49805 WP_000421815.1.49848 WP_000421815.1.49929 WP_000421815.1.50 WP_000421815.1.50080 WP_000421815.1.50128 WP_000421815.1.50161 WP_000421815.1.50198 WP_000421815.1.50211 WP_000421815.1.50239 WP_000421815.1.50251 WP_000421815.1.50349 WP_000421815.1.50374 WP_000421815.1.50376 WP_000421815.1.50386 WP_000421815.1.50389 WP_000421815.1.50404 WP_000421815.1.50413 WP_000421815.1.50449 WP_000421815.1.50469 WP_000421815.1.50478 WP_000421815.1.50480 WP_000421815.1.50517 WP_000421815.1.50563 WP_000421815.1.50576 WP_000421815.1.50593 WP_000421815.1.50676 WP_000421815.1.50769 WP_000421815.1.50774 WP_000421815.1.50782 WP_000421815.1.50804 WP_000421815.1.50808 WP_000421815.1.50811 WP_000421815.1.5088 WP_000421815.1.50882 WP_000421815.1.50905 WP_000421815.1.50908 WP_000421815.1.50918 WP_000421815.1.50960 WP_000421815.1.50999 WP_000421815.1.51014 WP_000421815.1.51022 WP_000421815.1.51036 WP_000421815.1.51066 WP_000421815.1.51117 WP_000421815.1.51131 WP_000421815.1.51178 WP_000421815.1.51179 WP_000421815.1.51182 WP_000421815.1.51186 WP_000421815.1.51224 WP_000421815.1.5125 WP_000421815.1.51331 WP_000421815.1.51356 WP_000421815.1.5138 WP_000421815.1.51412 WP_000421815.1.51414 WP_000421815.1.51419 WP_000421815.1.51451 WP_000421815.1.51487 WP_000421815.1.51488 WP_000421815.1.51502 WP_000421815.1.51506 WP_000421815.1.51518 WP_000421815.1.51555 WP_000421815.1.51594 WP_000421815.1.51615 WP_000421815.1.51634 WP_000421815.1.51642 WP_000421815.1.51686 WP_000421815.1.51700 WP_000421815.1.51704 WP_000421815.1.51756 WP_000421815.1.51764 WP_000421815.1.51831 WP_000421815.1.51841 WP_000421815.1.51868 WP_000421815.1.51888 WP_000421815.1.51900 WP_000421815.1.51910 WP_000421815.1.51911 WP_000421815.1.51914 WP_000421815.1.51930 WP_000421815.1.51932 WP_000421815.1.51989 WP_000421815.1.51994 WP_000421815.1.520 WP_000421815.1.5211 WP_000421815.1.52121 WP_000421815.1.52123 WP_000421815.1.52148 WP_000421815.1.5216 WP_000421815.1.52170 WP_000421815.1.52255 WP_000421815.1.52301 WP_000421815.1.52321 WP_000421815.1.52336 WP_000421815.1.52353 WP_000421815.1.52356 WP_000421815.1.52361 WP_000421815.1.52438 WP_000421815.1.52446 WP_000421815.1.52456 WP_000421815.1.52527 WP_000421815.1.52608 WP_000421815.1.52637 WP_000421815.1.52653 WP_000421815.1.52656 WP_000421815.1.52675 WP_000421815.1.52692 WP_000421815.1.52738 WP_000421815.1.52743 WP_000421815.1.52744 WP_000421815.1.52824 WP_000421815.1.52833 WP_000421815.1.52851 WP_000421815.1.52857 WP_000421815.1.52858 WP_000421815.1.52866 WP_000421815.1.52898 WP_000421815.1.52915 WP_000421815.1.52924 WP_000421815.1.52949 WP_000421815.1.52985 WP_000421815.1.5301 WP_000421815.1.5313 WP_000421815.1.53179 WP_000421815.1.53190 WP_000421815.1.53198 WP_000421815.1.53203 WP_000421815.1.53272 WP_000421815.1.53274 WP_000421815.1.53286 WP_000421815.1.53315 WP_000421815.1.53316 WP_000421815.1.53328 WP_000421815.1.5333 WP_000421815.1.53362 WP_000421815.1.53385 WP_000421815.1.53406 WP_000421815.1.53436 WP_000421815.1.53454 WP_000421815.1.53466 WP_000421815.1.53529 WP_000421815.1.53543 WP_000421815.1.53567 WP_000421815.1.53664 WP_000421815.1.53688 WP_000421815.1.53696 WP_000421815.1.53757 WP_000421815.1.53772 WP_000421815.1.53778 WP_000421815.1.53790 WP_000421815.1.53812 WP_000421815.1.53814 WP_000421815.1.53905 WP_000421815.1.5392 WP_000421815.1.53935 WP_000421815.1.54033 WP_000421815.1.54068 WP_000421815.1.54075 WP_000421815.1.54085 WP_000421815.1.54136 WP_000421815.1.5415 WP_000421815.1.54159 WP_000421815.1.54196 WP_000421815.1.542 WP_000421815.1.54209 WP_000421815.1.54271 WP_000421815.1.54273 WP_000421815.1.54274 WP_000421815.1.54319 WP_000421815.1.54324 WP_000421815.1.54364 WP_000421815.1.54400 WP_000421815.1.54469 WP_000421815.1.54500 WP_000421815.1.54522 WP_000421815.1.54526 WP_000421815.1.54558 WP_000421815.1.5456 WP_000421815.1.54569 WP_000421815.1.54607 WP_000421815.1.54644 WP_000421815.1.54662 WP_000421815.1.54722 WP_000421815.1.54749 WP_000421815.1.54764 WP_000421815.1.54774 WP_000421815.1.54814 WP_000421815.1.54822 WP_000421815.1.54827 WP_000421815.1.54845 WP_000421815.1.5485 WP_000421815.1.54877 WP_000421815.1.5493 WP_000421815.1.54984 WP_000421815.1.54992 WP_000421815.1.55008 WP_000421815.1.55073 WP_000421815.1.55152 WP_000421815.1.55156 WP_000421815.1.55166 WP_000421815.1.55178 WP_000421815.1.55224 WP_000421815.1.5523 WP_000421815.1.5525 WP_000421815.1.55285 WP_000421815.1.55294 WP_000421815.1.55325 WP_000421815.1.55418 WP_000421815.1.55430 WP_000421815.1.55461 WP_000421815.1.55475 WP_000421815.1.5552 WP_000421815.1.55528 WP_000421815.1.5555 WP_000421815.1.55554 WP_000421815.1.55557 WP_000421815.1.5560 WP_000421815.1.55614 WP_000421815.1.55647 WP_000421815.1.55672 WP_000421815.1.55680 WP_000421815.1.5572 WP_000421815.1.55743 WP_000421815.1.55768 WP_000421815.1.5577 WP_000421815.1.55782 WP_000421815.1.55796 WP_000421815.1.55803 WP_000421815.1.55853 WP_000421815.1.55923 WP_000421815.1.55973 WP_000421815.1.55993 WP_000421815.1.55995 WP_000421815.1.56002 WP_000421815.1.56004 WP_000421815.1.56012 WP_000421815.1.56026 WP_000421815.1.56069 WP_000421815.1.56082 WP_000421815.1.56105 WP_000421815.1.56130 WP_000421815.1.56235 WP_000421815.1.56238 WP_000421815.1.56244 WP_000421815.1.56261 WP_000421815.1.56263 WP_000421815.1.56286 WP_000421815.1.56304 WP_000421815.1.56305 WP_000421815.1.5633 WP_000421815.1.56354 WP_000421815.1.56385 WP_000421815.1.56389 WP_000421815.1.56396 WP_000421815.1.56413 WP_000421815.1.56414 WP_000421815.1.56420 WP_000421815.1.56438 WP_000421815.1.56468 WP_000421815.1.56559 WP_000421815.1.56560 WP_000421815.1.56597 WP_000421815.1.56601 WP_000421815.1.56614 WP_000421815.1.56615 WP_000421815.1.56642 WP_000421815.1.56647 WP_000421815.1.56660 WP_000421815.1.56671 WP_000421815.1.56682 WP_000421815.1.56824 WP_000421815.1.56853 WP_000421815.1.56861 WP_000421815.1.56877 WP_000421815.1.56893 WP_000421815.1.56898 WP_000421815.1.56950 WP_000421815.1.57000 WP_000421815.1.57026 WP_000421815.1.57076 WP_000421815.1.5711 WP_000421815.1.57143 WP_000421815.1.57168 WP_000421815.1.57187 WP_000421815.1.57232 WP_000421815.1.57233 WP_000421815.1.57246 WP_000421815.1.57296 WP_000421815.1.57307 WP_000421815.1.57344 WP_000421815.1.57356 WP_000421815.1.57377 WP_000421815.1.57418 WP_000421815.1.57433 WP_000421815.1.57494 WP_000421815.1.57495 WP_000421815.1.57510 WP_000421815.1.57515 WP_000421815.1.57529 WP_000421815.1.5753 WP_000421815.1.57555 WP_000421815.1.57559 WP_000421815.1.57576 WP_000421815.1.57601 WP_000421815.1.57607 WP_000421815.1.57709 WP_000421815.1.57710 WP_000421815.1.57735 WP_000421815.1.5774 WP_000421815.1.57763 WP_000421815.1.57778 WP_000421815.1.57781 WP_000421815.1.57797 WP_000421815.1.5781 WP_000421815.1.57835 WP_000421815.1.57857 WP_000421815.1.57862 WP_000421815.1.57890 WP_000421815.1.57891 WP_000421815.1.57893 WP_000421815.1.57978 WP_000421815.1.5801 WP_000421815.1.58040 WP_000421815.1.58041 WP_000421815.1.58090 WP_000421815.1.58131 WP_000421815.1.58144 WP_000421815.1.58153 WP_000421815.1.58239 WP_000421815.1.58251 WP_000421815.1.5828 WP_000421815.1.58334 WP_000421815.1.58358 WP_000421815.1.58372 WP_000421815.1.58407 WP_000421815.1.58416 WP_000421815.1.58418 WP_000421815.1.58442 WP_000421815.1.58443 WP_000421815.1.58451 WP_000421815.1.5846 WP_000421815.1.58489 WP_000421815.1.5854 WP_000421815.1.58548 WP_000421815.1.58564 WP_000421815.1.5858 WP_000421815.1.58604 WP_000421815.1.58633 WP_000421815.1.58662 WP_000421815.1.58669 WP_000421815.1.58675 WP_000421815.1.587 WP_000421815.1.58729 WP_000421815.1.58744 WP_000421815.1.58745 WP_000421815.1.58749 WP_000421815.1.5878 WP_000421815.1.58803 WP_000421815.1.58831 WP_000421815.1.58834 WP_000421815.1.58836 WP_000421815.1.5886 WP_000421815.1.58861 WP_000421815.1.58884 WP_000421815.1.59006 WP_000421815.1.59012 WP_000421815.1.59084 WP_000421815.1.59094 WP_000421815.1.59125 WP_000421815.1.59142 WP_000421815.1.59163 WP_000421815.1.59224 WP_000421815.1.59236 WP_000421815.1.5929 WP_000421815.1.59295 WP_000421815.1.59321 WP_000421815.1.59335 WP_000421815.1.59336 WP_000421815.1.59375 WP_000421815.1.59381 WP_000421815.1.59412 WP_000421815.1.59420 WP_000421815.1.59427 WP_000421815.1.59439 WP_000421815.1.59458 WP_000421815.1.59486 WP_000421815.1.59490 WP_000421815.1.59508 WP_000421815.1.59521 WP_000421815.1.5953 WP_000421815.1.59548 WP_000421815.1.59562 WP_000421815.1.59587 WP_000421815.1.59604 WP_000421815.1.59636 WP_000421815.1.59641 WP_000421815.1.59646 WP_000421815.1.59684 WP_000421815.1.59694 WP_000421815.1.59709 WP_000421815.1.59710 WP_000421815.1.59755 WP_000421815.1.59771 WP_000421815.1.5979 WP_000421815.1.59830 WP_000421815.1.59848 WP_000421815.1.59933 WP_000421815.1.59953 WP_000421815.1.59979 WP_000421815.1.60008 WP_000421815.1.60021 WP_000421815.1.60069 WP_000421815.1.60140 WP_000421815.1.60155 WP_000421815.1.60209 WP_000421815.1.60213 WP_000421815.1.60231 WP_000421815.1.60285 WP_000421815.1.6033 WP_000421815.1.60379 WP_000421815.1.60425 WP_000421815.1.60464 WP_000421815.1.60469 WP_000421815.1.60503 WP_000421815.1.60507 WP_000421815.1.6052 WP_000421815.1.60545 WP_000421815.1.60560 WP_000421815.1.60561 WP_000421815.1.60597 WP_000421815.1.60622 WP_000421815.1.60643 WP_000421815.1.60713 WP_000421815.1.60760 WP_000421815.1.60772 WP_000421815.1.60794 WP_000421815.1.60851 WP_000421815.1.60857 WP_000421815.1.6086 WP_000421815.1.60863 WP_000421815.1.60874 WP_000421815.1.6090 WP_000421815.1.60919 WP_000421815.1.60941 WP_000421815.1.60976 WP_000421815.1.60988 WP_000421815.1.60990 WP_000421815.1.61045 WP_000421815.1.61078 WP_000421815.1.61087 WP_000421815.1.61114 WP_000421815.1.6114 WP_000421815.1.61146 WP_000421815.1.61184 WP_000421815.1.61200 WP_000421815.1.61201 WP_000421815.1.61218 WP_000421815.1.61232 WP_000421815.1.6129 WP_000421815.1.61356 WP_000421815.1.61381 WP_000421815.1.61417 WP_000421815.1.61434 WP_000421815.1.61501 WP_000421815.1.61519 WP_000421815.1.61574 WP_000421815.1.61582 WP_000421815.1.61594 WP_000421815.1.61609 WP_000421815.1.6164 WP_000421815.1.61667 WP_000421815.1.61712 WP_000421815.1.61714 WP_000421815.1.61730 WP_000421815.1.61732 WP_000421815.1.61737 WP_000421815.1.61743 WP_000421815.1.61857 WP_000421815.1.61918 WP_000421815.1.61922 WP_000421815.1.61924 WP_000421815.1.61952 WP_000421815.1.61968 WP_000421815.1.62007 WP_000421815.1.62020 WP_000421815.1.62025 WP_000421815.1.6209 WP_000421815.1.62108 WP_000421815.1.62120 WP_000421815.1.62122 WP_000421815.1.62142 WP_000421815.1.62144 WP_000421815.1.62184 WP_000421815.1.62201 WP_000421815.1.62204 WP_000421815.1.62210 WP_000421815.1.62245 WP_000421815.1.62257 WP_000421815.1.62271 WP_000421815.1.62304 WP_000421815.1.62310 WP_000421815.1.62339 WP_000421815.1.62344 WP_000421815.1.62361 WP_000421815.1.62364 WP_000421815.1.62374 WP_000421815.1.62403 WP_000421815.1.62488 WP_000421815.1.62504 WP_000421815.1.62522 WP_000421815.1.6253 WP_000421815.1.62564 WP_000421815.1.62570 WP_000421815.1.62619 WP_000421815.1.62677 WP_000421815.1.62693 WP_000421815.1.627 WP_000421815.1.62725 WP_000421815.1.62828 WP_000421815.1.62853 WP_000421815.1.62903 WP_000421815.1.62955 WP_000421815.1.62976 WP_000421815.1.62983 WP_000421815.1.62988 WP_000421815.1.63063 WP_000421815.1.63102 WP_000421815.1.63129 WP_000421815.1.63155 WP_000421815.1.63181 WP_000421815.1.63186 WP_000421815.1.63203 WP_000421815.1.63229 WP_000421815.1.63250 WP_000421815.1.63256 WP_000421815.1.63290 WP_000421815.1.63358 WP_000421815.1.63382 WP_000421815.1.63422 WP_000421815.1.63432 WP_000421815.1.63455 WP_000421815.1.63461 WP_000421815.1.63479 WP_000421815.1.63499 WP_000421815.1.63509 WP_000421815.1.63513 WP_000421815.1.63525 WP_000421815.1.63529 WP_000421815.1.63568 WP_000421815.1.6357 WP_000421815.1.63577 WP_000421815.1.63585 WP_000421815.1.63633 WP_000421815.1.63664 WP_000421815.1.6367 WP_000421815.1.63677 WP_000421815.1.63690 WP_000421815.1.6370 WP_000421815.1.63718 WP_000421815.1.63731 WP_000421815.1.63748 WP_000421815.1.6375 WP_000421815.1.63757 WP_000421815.1.63782 WP_000421815.1.63797 WP_000421815.1.63834 WP_000421815.1.63851 WP_000421815.1.63860 WP_000421815.1.63864 WP_000421815.1.63866 WP_000421815.1.63903 WP_000421815.1.63912 WP_000421815.1.63934 WP_000421815.1.63958 WP_000421815.1.63977 WP_000421815.1.6399 WP_000421815.1.64007 WP_000421815.1.64010 WP_000421815.1.64018 WP_000421815.1.64034 WP_000421815.1.64046 WP_000421815.1.64072 WP_000421815.1.64085 WP_000421815.1.64109 WP_000421815.1.64121 WP_000421815.1.6423 WP_000421815.1.64244 WP_000421815.1.64294 WP_000421815.1.64350 WP_000421815.1.64385 WP_000421815.1.64387 WP_000421815.1.64389 WP_000421815.1.64403 WP_000421815.1.64462 WP_000421815.1.6451 WP_000421815.1.64569 WP_000421815.1.64597 WP_000421815.1.64649 WP_000421815.1.64667 WP_000421815.1.64674 WP_000421815.1.64690 WP_000421815.1.64702 WP_000421815.1.64757 WP_000421815.1.64781 WP_000421815.1.64798 WP_000421815.1.64831 WP_000421815.1.6489 WP_000421815.1.64920 WP_000421815.1.64944 WP_000421815.1.64972 WP_000421815.1.64977 WP_000421815.1.65011 WP_000421815.1.65016 WP_000421815.1.65018 WP_000421815.1.65022 WP_000421815.1.65027 WP_000421815.1.65028 WP_000421815.1.65052 WP_000421815.1.65163 WP_000421815.1.65171 WP_000421815.1.65248 WP_000421815.1.6525 WP_000421815.1.65269 WP_000421815.1.65348 WP_000421815.1.6535 WP_000421815.1.65357 WP_000421815.1.65363 WP_000421815.1.65394 WP_000421815.1.65437 WP_000421815.1.65474 WP_000421815.1.6550 WP_000421815.1.65508 WP_000421815.1.65538 WP_000421815.1.65558 WP_000421815.1.65572 WP_000421815.1.6560 WP_000421815.1.65601 WP_000421815.1.6561 WP_000421815.1.65633 WP_000421815.1.6565 WP_000421815.1.65687 WP_000421815.1.65696 WP_000421815.1.65698 WP_000421815.1.6575 WP_000421815.1.65771 WP_000421815.1.65782 WP_000421815.1.65849 WP_000421815.1.65883 WP_000421815.1.65901 WP_000421815.1.65940 WP_000421815.1.65956 WP_000421815.1.65968 WP_000421815.1.66049 WP_000421815.1.66074 WP_000421815.1.66085 WP_000421815.1.66122 WP_000421815.1.66171 WP_000421815.1.66250 WP_000421815.1.66270 WP_000421815.1.66289 WP_000421815.1.6630 WP_000421815.1.66314 WP_000421815.1.66315 WP_000421815.1.66330 WP_000421815.1.66358 WP_000421815.1.66362 WP_000421815.1.66368 WP_000421815.1.6638 WP_000421815.1.66385 WP_000421815.1.6640 WP_000421815.1.66446 WP_000421815.1.66462 WP_000421815.1.66539 WP_000421815.1.66630 WP_000421815.1.66678 WP_000421815.1.66698 WP_000421815.1.66702 WP_000421815.1.66779 WP_000421815.1.6680 WP_000421815.1.66807 WP_000421815.1.66820 WP_000421815.1.66825 WP_000421815.1.66834 WP_000421815.1.66876 WP_000421815.1.66901 WP_000421815.1.66937 WP_000421815.1.66959 WP_000421815.1.66962 WP_000421815.1.67 WP_000421815.1.67037 WP_000421815.1.67045 WP_000421815.1.67100 WP_000421815.1.67173 WP_000421815.1.67175 WP_000421815.1.67181 WP_000421815.1.67268 WP_000421815.1.67279 WP_000421815.1.67288 WP_000421815.1.67347 WP_000421815.1.6739 WP_000421815.1.67405 WP_000421815.1.67552 WP_000421815.1.6760 WP_000421815.1.67603 WP_000421815.1.67617 WP_000421815.1.67633 WP_000421815.1.67637 WP_000421815.1.67682 WP_000421815.1.67707 WP_000421815.1.67772 WP_000421815.1.67776 WP_000421815.1.67803 WP_000421815.1.67814 WP_000421815.1.6782 WP_000421815.1.67827 WP_000421815.1.67829 WP_000421815.1.6785 WP_000421815.1.67887 WP_000421815.1.67969 WP_000421815.1.67970 WP_000421815.1.67977 WP_000421815.1.68075 WP_000421815.1.6809 WP_000421815.1.68115 WP_000421815.1.68201 WP_000421815.1.68206 WP_000421815.1.68210 WP_000421815.1.6827 WP_000421815.1.68275 WP_000421815.1.6833 WP_000421815.1.68401 WP_000421815.1.68477 WP_000421815.1.68478 WP_000421815.1.6849 WP_000421815.1.68532 WP_000421815.1.68547 WP_000421815.1.6857 WP_000421815.1.6858 WP_000421815.1.68589 WP_000421815.1.68591 WP_000421815.1.68652 WP_000421815.1.68655 WP_000421815.1.68656 WP_000421815.1.68658 WP_000421815.1.68677 WP_000421815.1.6869 WP_000421815.1.6875 WP_000421815.1.68778 WP_000421815.1.68787 WP_000421815.1.6879 WP_000421815.1.68816 WP_000421815.1.6883 WP_000421815.1.68893 WP_000421815.1.68894 WP_000421815.1.68928 WP_000421815.1.68966 WP_000421815.1.68975 WP_000421815.1.69001 WP_000421815.1.69011 WP_000421815.1.69029 WP_000421815.1.6904 WP_000421815.1.6905 WP_000421815.1.69058 WP_000421815.1.69086 WP_000421815.1.6913 WP_000421815.1.69131 WP_000421815.1.69146 WP_000421815.1.69151 WP_000421815.1.69236 WP_000421815.1.69255 WP_000421815.1.69273 WP_000421815.1.69359 WP_000421815.1.69371 WP_000421815.1.69385 WP_000421815.1.69397 WP_000421815.1.69465 WP_000421815.1.6954 WP_000421815.1.69554 WP_000421815.1.69564 WP_000421815.1.69575 WP_000421815.1.69588 WP_000421815.1.69592 WP_000421815.1.69597 WP_000421815.1.69616 WP_000421815.1.69636 WP_000421815.1.69644 WP_000421815.1.69696 WP_000421815.1.69704 WP_000421815.1.69710 WP_000421815.1.69758 WP_000421815.1.69760 WP_000421815.1.69767 WP_000421815.1.69787 WP_000421815.1.69790 WP_000421815.1.69808 WP_000421815.1.69817 WP_000421815.1.69848 WP_000421815.1.69965 WP_000421815.1.69975 WP_000421815.1.69977 WP_000421815.1.69982 WP_000421815.1.70003 WP_000421815.1.70028 WP_000421815.1.70047 WP_000421815.1.70087 WP_000421815.1.70169 WP_000421815.1.70183 WP_000421815.1.7021 WP_000421815.1.70241 WP_000421815.1.70248 WP_000421815.1.70269 WP_000421815.1.70272 WP_000421815.1.70281 WP_000421815.1.70289 WP_000421815.1.70303 WP_000421815.1.70321 WP_000421815.1.70327 WP_000421815.1.70355 WP_000421815.1.7044 WP_000421815.1.70440 WP_000421815.1.70447 WP_000421815.1.70485 WP_000421815.1.70488 WP_000421815.1.70491 WP_000421815.1.70531 WP_000421815.1.7055 WP_000421815.1.70580 WP_000421815.1.70596 WP_000421815.1.70643 WP_000421815.1.70678 WP_000421815.1.70685 WP_000421815.1.70712 WP_000421815.1.70732 WP_000421815.1.70733 WP_000421815.1.70761 WP_000421815.1.70792 WP_000421815.1.70797 WP_000421815.1.70837 WP_000421815.1.70869 WP_000421815.1.70883 WP_000421815.1.70899 WP_000421815.1.70922 WP_000421815.1.70929 WP_000421815.1.7093 WP_000421815.1.70948 WP_000421815.1.70959 WP_000421815.1.70969 WP_000421815.1.70971 WP_000421815.1.70977 WP_000421815.1.70985 WP_000421815.1.70986 WP_000421815.1.71007 WP_000421815.1.71010 WP_000421815.1.71023 WP_000421815.1.71069 WP_000421815.1.71088 WP_000421815.1.7110 WP_000421815.1.71116 WP_000421815.1.71120 WP_000421815.1.71146 WP_000421815.1.71150 WP_000421815.1.71165 WP_000421815.1.71171 WP_000421815.1.71172 WP_000421815.1.71184 WP_000421815.1.71188 WP_000421815.1.71201 WP_000421815.1.71202 WP_000421815.1.71243 WP_000421815.1.71268 WP_000421815.1.71299 WP_000421815.1.71306 WP_000421815.1.7134 WP_000421815.1.71363 WP_000421815.1.71378 WP_000421815.1.714 WP_000421815.1.71401 WP_000421815.1.7142 WP_000421815.1.71446 WP_000421815.1.71450 WP_000421815.1.71452 WP_000421815.1.71481 WP_000421815.1.71583 WP_000421815.1.71600 WP_000421815.1.71626 WP_000421815.1.71636 WP_000421815.1.71691 WP_000421815.1.71702 WP_000421815.1.7174 WP_000421815.1.71746 WP_000421815.1.71750 WP_000421815.1.71756 WP_000421815.1.71798 WP_000421815.1.71881 WP_000421815.1.71908 WP_000421815.1.71923 WP_000421815.1.71941 WP_000421815.1.71952 WP_000421815.1.71973 WP_000421815.1.71979 WP_000421815.1.71984 WP_000421815.1.72065 WP_000421815.1.72068 WP_000421815.1.72100 WP_000421815.1.72105 WP_000421815.1.72119 WP_000421815.1.72182 WP_000421815.1.72188 WP_000421815.1.72190 WP_000421815.1.72203 WP_000421815.1.72226 WP_000421815.1.72234 WP_000421815.1.72243 WP_000421815.1.72281 WP_000421815.1.72283 WP_000421815.1.72307 WP_000421815.1.72372 WP_000421815.1.72376 WP_000421815.1.72403 WP_000421815.1.72412 WP_000421815.1.7243 WP_000421815.1.72438 WP_000421815.1.72470 WP_000421815.1.72594 WP_000421815.1.72602 WP_000421815.1.72625 WP_000421815.1.72629 WP_000421815.1.72642 WP_000421815.1.72671 WP_000421815.1.72689 WP_000421815.1.72716 WP_000421815.1.72718 WP_000421815.1.72728 WP_000421815.1.72793 WP_000421815.1.72850 WP_000421815.1.72865 WP_000421815.1.72871 WP_000421815.1.72872 WP_000421815.1.72887 WP_000421815.1.72897 WP_000421815.1.72944 WP_000421815.1.72975 WP_000421815.1.73062 WP_000421815.1.73125 WP_000421815.1.7315 WP_000421815.1.7316 WP_000421815.1.73200 WP_000421815.1.73328 WP_000421815.1.7334 WP_000421815.1.73362 WP_000421815.1.73377 WP_000421815.1.73379 WP_000421815.1.7341 WP_000421815.1.73461 WP_000421815.1.73481 WP_000421815.1.73512 WP_000421815.1.73535 WP_000421815.1.7356 WP_000421815.1.73561 WP_000421815.1.73581 WP_000421815.1.73617 WP_000421815.1.73667 WP_000421815.1.73669 WP_000421815.1.73701 WP_000421815.1.73708 WP_000421815.1.7374 WP_000421815.1.73753 WP_000421815.1.73758 WP_000421815.1.73764 WP_000421815.1.73794 WP_000421815.1.73804 WP_000421815.1.73831 WP_000421815.1.73847 WP_000421815.1.7387 WP_000421815.1.73926 WP_000421815.1.73945 WP_000421815.1.73965 WP_000421815.1.74028 WP_000421815.1.74040 WP_000421815.1.7405 WP_000421815.1.74089 WP_000421815.1.74174 WP_000421815.1.74181 WP_000421815.1.74191 WP_000421815.1.74207 WP_000421815.1.74228 WP_000421815.1.74248 WP_000421815.1.743 WP_000421815.1.74300 WP_000421815.1.74379 WP_000421815.1.74410 WP_000421815.1.74414 WP_000421815.1.74454 WP_000421815.1.74466 WP_000421815.1.74469 WP_000421815.1.74481 WP_000421815.1.745 WP_000421815.1.74529 WP_000421815.1.74545 WP_000421815.1.74578 WP_000421815.1.7458 WP_000421815.1.74620 WP_000421815.1.74644 WP_000421815.1.74661 WP_000421815.1.74702 WP_000421815.1.74745 WP_000421815.1.74757 WP_000421815.1.74806 WP_000421815.1.74876 WP_000421815.1.74946 WP_000421815.1.75009 WP_000421815.1.75051 WP_000421815.1.75056 WP_000421815.1.75058 WP_000421815.1.75129 WP_000421815.1.75134 WP_000421815.1.75159 WP_000421815.1.75168 WP_000421815.1.75177 WP_000421815.1.75187 WP_000421815.1.75288 WP_000421815.1.75301 WP_000421815.1.7531 WP_000421815.1.75334 WP_000421815.1.75362 WP_000421815.1.75385 WP_000421815.1.75392 WP_000421815.1.75400 WP_000421815.1.7543 WP_000421815.1.75450 WP_000421815.1.75494 WP_000421815.1.7558 WP_000421815.1.75585 WP_000421815.1.75607 WP_000421815.1.75609 WP_000421815.1.75626 WP_000421815.1.75664 WP_000421815.1.75703 WP_000421815.1.75716 WP_000421815.1.75740 WP_000421815.1.75751 WP_000421815.1.75760 WP_000421815.1.75764 WP_000421815.1.75828 WP_000421815.1.75837 WP_000421815.1.75873 WP_000421815.1.75874 WP_000421815.1.75884 WP_000421815.1.75945 WP_000421815.1.76 WP_000421815.1.76020 WP_000421815.1.76024 WP_000421815.1.76055 WP_000421815.1.76097 WP_000421815.1.76102 WP_000421815.1.76108 WP_000421815.1.76156 WP_000421815.1.76164 WP_000421815.1.76186 WP_000421815.1.76197 WP_000421815.1.76252 WP_000421815.1.7629 WP_000421815.1.76327 WP_000421815.1.7634 WP_000421815.1.76345 WP_000421815.1.76364 WP_000421815.1.76445 WP_000421815.1.76471 WP_000421815.1.76529 WP_000421815.1.76532 WP_000421815.1.76548 WP_000421815.1.7657 WP_000421815.1.76576 WP_000421815.1.7660 WP_000421815.1.76611 WP_000421815.1.76673 WP_000421815.1.76706 WP_000421815.1.7672 WP_000421815.1.76721 WP_000421815.1.76756 WP_000421815.1.76760 WP_000421815.1.76776 WP_000421815.1.76799 WP_000421815.1.76806 WP_000421815.1.7684 WP_000421815.1.76866 WP_000421815.1.76875 WP_000421815.1.76880 WP_000421815.1.76899 WP_000421815.1.76913 WP_000421815.1.76968 WP_000421815.1.77017 WP_000421815.1.77038 WP_000421815.1.77047 WP_000421815.1.77067 WP_000421815.1.77080 WP_000421815.1.7712 WP_000421815.1.77177 WP_000421815.1.77180 WP_000421815.1.77241 WP_000421815.1.77244 WP_000421815.1.77267 WP_000421815.1.77292 WP_000421815.1.77306 WP_000421815.1.77313 WP_000421815.1.77349 WP_000421815.1.77356 WP_000421815.1.77390 WP_000421815.1.77414 WP_000421815.1.77431 WP_000421815.1.77440 WP_000421815.1.77475 WP_000421815.1.77529 WP_000421815.1.77549 WP_000421815.1.77555 WP_000421815.1.77575 WP_000421815.1.77596 WP_000421815.1.77629 WP_000421815.1.77646 WP_000421815.1.77653 WP_000421815.1.77692 WP_000421815.1.77710 WP_000421815.1.77729 WP_000421815.1.77761 WP_000421815.1.7782 WP_000421815.1.77846 WP_000421815.1.77851 WP_000421815.1.77871 WP_000421815.1.77898 WP_000421815.1.77918 WP_000421815.1.7792 WP_000421815.1.7793 WP_000421815.1.77960 WP_000421815.1.77971 WP_000421815.1.77989 WP_000421815.1.78 WP_000421815.1.78016 WP_000421815.1.78051 WP_000421815.1.78076 WP_000421815.1.78096 WP_000421815.1.78100 WP_000421815.1.78110 WP_000421815.1.7814 WP_000421815.1.78170 WP_000421815.1.78180 WP_000421815.1.78201 WP_000421815.1.78259 WP_000421815.1.78301 WP_000421815.1.78366 WP_000421815.1.78372 WP_000421815.1.78383 WP_000421815.1.78407 WP_000421815.1.78443 WP_000421815.1.78495 WP_000421815.1.78496 WP_000421815.1.78501 WP_000421815.1.78502 WP_000421815.1.78603 WP_000421815.1.7861 WP_000421815.1.78618 WP_000421815.1.78658 WP_000421815.1.78673 WP_000421815.1.78735 WP_000421815.1.78738 WP_000421815.1.78771 WP_000421815.1.78789 WP_000421815.1.78802 WP_000421815.1.78830 WP_000421815.1.78835 WP_000421815.1.78838 WP_000421815.1.78871 WP_000421815.1.78874 WP_000421815.1.78881 WP_000421815.1.78918 WP_000421815.1.78928 WP_000421815.1.78930 WP_000421815.1.79011 WP_000421815.1.79081 WP_000421815.1.79099 WP_000421815.1.79140 WP_000421815.1.79151 WP_000421815.1.79167 WP_000421815.1.79189 WP_000421815.1.79203 WP_000421815.1.79235 WP_000421815.1.79335 WP_000421815.1.794 WP_000421815.1.79427 WP_000421815.1.79462 WP_000421815.1.79466 WP_000421815.1.79472 WP_000421815.1.79490 WP_000421815.1.79495 WP_000421815.1.79529 WP_000421815.1.7956 WP_000421815.1.79570 WP_000421815.1.79586 WP_000421815.1.79635 WP_000421815.1.7964 WP_000421815.1.79642 WP_000421815.1.79659 WP_000421815.1.79668 WP_000421815.1.79708 WP_000421815.1.7972 WP_000421815.1.79734 WP_000421815.1.79738 WP_000421815.1.79757 WP_000421815.1.79778 WP_000421815.1.7979 WP_000421815.1.7982 WP_000421815.1.79845 WP_000421815.1.79867 WP_000421815.1.79892 WP_000421815.1.7991 WP_000421815.1.79934 WP_000421815.1.7994 WP_000421815.1.79945 WP_000421815.1.79951 WP_000421815.1.79974 WP_000421815.1.79996 WP_000421815.1.80077 WP_000421815.1.80137 WP_000421815.1.80149 WP_000421815.1.80182 WP_000421815.1.80229 WP_000421815.1.80236 WP_000421815.1.8024 WP_000421815.1.80249 WP_000421815.1.80250 WP_000421815.1.80293 WP_000421815.1.80296 WP_000421815.1.80307 WP_000421815.1.80366 WP_000421815.1.80441 WP_000421815.1.80473 WP_000421815.1.80496 WP_000421815.1.80529 WP_000421815.1.80586 WP_000421815.1.80629 WP_000421815.1.80638 WP_000421815.1.80651 WP_000421815.1.80707 WP_000421815.1.80723 WP_000421815.1.80725 WP_000421815.1.80741 WP_000421815.1.80757 WP_000421815.1.80760 WP_000421815.1.80780 WP_000421815.1.80803 WP_000421815.1.80819 WP_000421815.1.80831 WP_000421815.1.80840 WP_000421815.1.80850 WP_000421815.1.80857 WP_000421815.1.80868 WP_000421815.1.80874 WP_000421815.1.80881 WP_000421815.1.80927 WP_000421815.1.80939 WP_000421815.1.8096 WP_000421815.1.81037 WP_000421815.1.8106 WP_000421815.1.81067 WP_000421815.1.81069 WP_000421815.1.81110 WP_000421815.1.81118 WP_000421815.1.81149 WP_000421815.1.81175 WP_000421815.1.8119 WP_000421815.1.81193 WP_000421815.1.81225 WP_000421815.1.81231 WP_000421815.1.81275 WP_000421815.1.81302 WP_000421815.1.81305 WP_000421815.1.81328 WP_000421815.1.8134 WP_000421815.1.81354 WP_000421815.1.81388 WP_000421815.1.81404 WP_000421815.1.81409 WP_000421815.1.81410 WP_000421815.1.81425 WP_000421815.1.81455 WP_000421815.1.81472 WP_000421815.1.81504 WP_000421815.1.81528 WP_000421815.1.81548 WP_000421815.1.81668 WP_000421815.1.8168 WP_000421815.1.81727 WP_000421815.1.81735 WP_000421815.1.81736 WP_000421815.1.81743 WP_000421815.1.81746 WP_000421815.1.81750 WP_000421815.1.81760 WP_000421815.1.81768 WP_000421815.1.81785 WP_000421815.1.81902 WP_000421815.1.81941 WP_000421815.1.81974 WP_000421815.1.81995 WP_000421815.1.82037 WP_000421815.1.82144 WP_000421815.1.82149 WP_000421815.1.82192 WP_000421815.1.82232 WP_000421815.1.82258 WP_000421815.1.82269 WP_000421815.1.82352 WP_000421815.1.8236 WP_000421815.1.82369 WP_000421815.1.82401 WP_000421815.1.82420 WP_000421815.1.82434 WP_000421815.1.82464 WP_000421815.1.8247 WP_000421815.1.82479 WP_000421815.1.82503 WP_000421815.1.82515 WP_000421815.1.82529 WP_000421815.1.82530 WP_000421815.1.82562 WP_000421815.1.82569 WP_000421815.1.82570 WP_000421815.1.82636 WP_000421815.1.82637 WP_000421815.1.82648 WP_000421815.1.82676 WP_000421815.1.82761 WP_000421815.1.8282 WP_000421815.1.82841 WP_000421815.1.82843 WP_000421815.1.82867 WP_000421815.1.82886 WP_000421815.1.82899 WP_000421815.1.82937 WP_000421815.1.82944 WP_000421815.1.82946 WP_000421815.1.82956 WP_000421815.1.82964 WP_000421815.1.82992 WP_000421815.1.83005 WP_000421815.1.83006 WP_000421815.1.83092 WP_000421815.1.83128 WP_000421815.1.83139 WP_000421815.1.83163 WP_000421815.1.83204 WP_000421815.1.83221 WP_000421815.1.83247 WP_000421815.1.83252 WP_000421815.1.83258 WP_000421815.1.83301 WP_000421815.1.83305 WP_000421815.1.83331 WP_000421815.1.83356 WP_000421815.1.83360 WP_000421815.1.83365 WP_000421815.1.83378 WP_000421815.1.83382 WP_000421815.1.83388 WP_000421815.1.83413 WP_000421815.1.83491 WP_000421815.1.83523 WP_000421815.1.8354 WP_000421815.1.83558 WP_000421815.1.83598 WP_000421815.1.83650 WP_000421815.1.83651 WP_000421815.1.83710 WP_000421815.1.83721 WP_000421815.1.83760 WP_000421815.1.83854 WP_000421815.1.83979 WP_000421815.1.8399 WP_000421815.1.83995 WP_000421815.1.84000 WP_000421815.1.84011 WP_000421815.1.84031 WP_000421815.1.84103 WP_000421815.1.84115 WP_000421815.1.84168 WP_000421815.1.84179 WP_000421815.1.84198 WP_000421815.1.84209 WP_000421815.1.84229 WP_000421815.1.8425 WP_000421815.1.84283 WP_000421815.1.84291 WP_000421815.1.84325 WP_000421815.1.84355 WP_000421815.1.84359 WP_000421815.1.84373 WP_000421815.1.84392 WP_000421815.1.84397 WP_000421815.1.84403 WP_000421815.1.8441 WP_000421815.1.84459 WP_000421815.1.84461 WP_000421815.1.84475 WP_000421815.1.84497 WP_000421815.1.84515 WP_000421815.1.84523 WP_000421815.1.84532 WP_000421815.1.84551 WP_000421815.1.84572 WP_000421815.1.84598 WP_000421815.1.84644 WP_000421815.1.84659 WP_000421815.1.84693 WP_000421815.1.84711 WP_000421815.1.84721 WP_000421815.1.84745 WP_000421815.1.84899 WP_000421815.1.849 WP_000421815.1.8497 WP_000421815.1.850 WP_000421815.1.85014 WP_000421815.1.85031 WP_000421815.1.85040 WP_000421815.1.85079 WP_000421815.1.85094 WP_000421815.1.85147 WP_000421815.1.85178 WP_000421815.1.85180 WP_000421815.1.85190 WP_000421815.1.85192 WP_000421815.1.85217 WP_000421815.1.85301 WP_000421815.1.8537 WP_000421815.1.85408 WP_000421815.1.85433 WP_000421815.1.8545 WP_000421815.1.85456 WP_000421815.1.85481 WP_000421815.1.85483 WP_000421815.1.85541 WP_000421815.1.8556 WP_000421815.1.85568 WP_000421815.1.85615 WP_000421815.1.85617 WP_000421815.1.85654 WP_000421815.1.85663 WP_000421815.1.85671 WP_000421815.1.85672 WP_000421815.1.85675 WP_000421815.1.85723 WP_000421815.1.85759 WP_000421815.1.85777 WP_000421815.1.85780 WP_000421815.1.85797 WP_000421815.1.85855 WP_000421815.1.85864 WP_000421815.1.85886 WP_000421815.1.85900 WP_000421815.1.85904 WP_000421815.1.8591 WP_000421815.1.85943 WP_000421815.1.85976 WP_000421815.1.85982 WP_000421815.1.86007 WP_000421815.1.86010 WP_000421815.1.86017 WP_000421815.1.86043 WP_000421815.1.86092 WP_000421815.1.86120 WP_000421815.1.86126 WP_000421815.1.86159 WP_000421815.1.8616 WP_000421815.1.86173 WP_000421815.1.86206 WP_000421815.1.86224 WP_000421815.1.86259 WP_000421815.1.86284 WP_000421815.1.86306 WP_000421815.1.86310 WP_000421815.1.86347 WP_000421815.1.86356 WP_000421815.1.86380 WP_000421815.1.86442 WP_000421815.1.86450 WP_000421815.1.86453 WP_000421815.1.86469 WP_000421815.1.86580 WP_000421815.1.86588 WP_000421815.1.86593 WP_000421815.1.86634 WP_000421815.1.86658 WP_000421815.1.86661 WP_000421815.1.86676 WP_000421815.1.86699 WP_000421815.1.8671 WP_000421815.1.8672 WP_000421815.1.86735 WP_000421815.1.86744 WP_000421815.1.8678 WP_000421815.1.86810 WP_000421815.1.8684 WP_000421815.1.86859 WP_000421815.1.86895 WP_000421815.1.86902 WP_000421815.1.86906 WP_000421815.1.8691 WP_000421815.1.86921 WP_000421815.1.87095 WP_000421815.1.87143 WP_000421815.1.87148 WP_000421815.1.8722 WP_000421815.1.87265 WP_000421815.1.87282 WP_000421815.1.87283 WP_000421815.1.87323 WP_000421815.1.8736 WP_000421815.1.87365 WP_000421815.1.87460 WP_000421815.1.87500 WP_000421815.1.87552 WP_000421815.1.87583 WP_000421815.1.87584 WP_000421815.1.87626 WP_000421815.1.8767 WP_000421815.1.87687 WP_000421815.1.87695 WP_000421815.1.87760 WP_000421815.1.87779 WP_000421815.1.87875 WP_000421815.1.87899 WP_000421815.1.87905 WP_000421815.1.8792 WP_000421815.1.87933 WP_000421815.1.87936 WP_000421815.1.87999 WP_000421815.1.8800 WP_000421815.1.88014 WP_000421815.1.8809 WP_000421815.1.88092 WP_000421815.1.88174 WP_000421815.1.88214 WP_000421815.1.88222 WP_000421815.1.88244 WP_000421815.1.88275 WP_000421815.1.88291 WP_000421815.1.88293 WP_000421815.1.88303 WP_000421815.1.88356 WP_000421815.1.8837 WP_000421815.1.88393 WP_000421815.1.88423 WP_000421815.1.88474 WP_000421815.1.8849 WP_000421815.1.88508 WP_000421815.1.88597 WP_000421815.1.88609 WP_000421815.1.88620 WP_000421815.1.88675 WP_000421815.1.88683 WP_000421815.1.88703 WP_000421815.1.88731 WP_000421815.1.88776 WP_000421815.1.88792 WP_000421815.1.88845 WP_000421815.1.88854 WP_000421815.1.88902 WP_000421815.1.8891 WP_000421815.1.88942 WP_000421815.1.88957 WP_000421815.1.88970 WP_000421815.1.88980 WP_000421815.1.88981 WP_000421815.1.88982 WP_000421815.1.88995 WP_000421815.1.88998 WP_000421815.1.89054 WP_000421815.1.89114 WP_000421815.1.89116 WP_000421815.1.89119 WP_000421815.1.89120 WP_000421815.1.89138 WP_000421815.1.89174 WP_000421815.1.89177 WP_000421815.1.89188 WP_000421815.1.89215 WP_000421815.1.89291 WP_000421815.1.89355 WP_000421815.1.89462 WP_000421815.1.89512 WP_000421815.1.89527 WP_000421815.1.89570 WP_000421815.1.89580 WP_000421815.1.89604 WP_000421815.1.89606 WP_000421815.1.8961 WP_000421815.1.89622 WP_000421815.1.89634 WP_000421815.1.89647 WP_000421815.1.89657 WP_000421815.1.89659 WP_000421815.1.89746 WP_000421815.1.89765 WP_000421815.1.89777 WP_000421815.1.89789 WP_000421815.1.89817 WP_000421815.1.89832 WP_000421815.1.89870 WP_000421815.1.89902 WP_000421815.1.89914 WP_000421815.1.8996 WP_000421815.1.89975 WP_000421815.1.90033 WP_000421815.1.90084 WP_000421815.1.90097 WP_000421815.1.90211 WP_000421815.1.90220 WP_000421815.1.90252 WP_000421815.1.90293 WP_000421815.1.90311 WP_000421815.1.90348 WP_000421815.1.90363 WP_000421815.1.90409 WP_000421815.1.90417 WP_000421815.1.90453 WP_000421815.1.90458 WP_000421815.1.90472 WP_000421815.1.90521 WP_000421815.1.90522 WP_000421815.1.90557 WP_000421815.1.90563 WP_000421815.1.90566 WP_000421815.1.90585 WP_000421815.1.90620 WP_000421815.1.90641 WP_000421815.1.90734 WP_000421815.1.90748 WP_000421815.1.90759 WP_000421815.1.90792 WP_000421815.1.90814 WP_000421815.1.90859 WP_000421815.1.90876 WP_000421815.1.9089 WP_000421815.1.9093 WP_000421815.1.90959 WP_000421815.1.90983 WP_000421815.1.90991 WP_000421815.1.91003 WP_000421815.1.91023 WP_000421815.1.91042 WP_000421815.1.91056 WP_000421815.1.91069 WP_000421815.1.91107 WP_000421815.1.91156 WP_000421815.1.91179 WP_000421815.1.91189 WP_000421815.1.91215 WP_000421815.1.91278 WP_000421815.1.9131 WP_000421815.1.91334 WP_000421815.1.9137 WP_000421815.1.91372 WP_000421815.1.91381 WP_000421815.1.91405 WP_000421815.1.91459 WP_000421815.1.91470 WP_000421815.1.91473 WP_000421815.1.91493 WP_000421815.1.91505 WP_000421815.1.91512 WP_000421815.1.91524 WP_000421815.1.91528 WP_000421815.1.91564 WP_000421815.1.91621 WP_000421815.1.91625 WP_000421815.1.91628 WP_000421815.1.91655 WP_000421815.1.91724 WP_000421815.1.91732 WP_000421815.1.91736 WP_000421815.1.91742 WP_000421815.1.91776 WP_000421815.1.91788 WP_000421815.1.91806 WP_000421815.1.91864 WP_000421815.1.91880 WP_000421815.1.91898 WP_000421815.1.91903 WP_000421815.1.91904 WP_000421815.1.91914 WP_000421815.1.92013 WP_000421815.1.92044 WP_000421815.1.92060 WP_000421815.1.92067 WP_000421815.1.92068 WP_000421815.1.92093 WP_000421815.1.92099 WP_000421815.1.92108 WP_000421815.1.92122 WP_000421815.1.92149 WP_000421815.1.92165 WP_000421815.1.92171 WP_000421815.1.92183 WP_000421815.1.92208 WP_000421815.1.92213 WP_000421815.1.9222 WP_000421815.1.92270 WP_000421815.1.92299 WP_000421815.1.92310 WP_000421815.1.92318 WP_000421815.1.92375 WP_000421815.1.92394 WP_000421815.1.92399 WP_000421815.1.92408 WP_000421815.1.92411 WP_000421815.1.92443 WP_000421815.1.92452 WP_000421815.1.92482 WP_000421815.1.9253 WP_000421815.1.92531 WP_000421815.1.92557 WP_000421815.1.92562 WP_000421815.1.92575 WP_000421815.1.92628 WP_000421815.1.92659 WP_000421815.1.92669 WP_000421815.1.92671 WP_000421815.1.92729 WP_000421815.1.92738 WP_000421815.1.92754 WP_000421815.1.92758 WP_000421815.1.92806 WP_000421815.1.92827 WP_000421815.1.92832 WP_000421815.1.92836 WP_000421815.1.92843 WP_000421815.1.92879 WP_000421815.1.92883 WP_000421815.1.92890 WP_000421815.1.92893 WP_000421815.1.92926 WP_000421815.1.92947 WP_000421815.1.92975 WP_000421815.1.92988 WP_000421815.1.93059 WP_000421815.1.93086 WP_000421815.1.93101 WP_000421815.1.93136 WP_000421815.1.93155 WP_000421815.1.93215 WP_000421815.1.93275 WP_000421815.1.93322 WP_000421815.1.93339 WP_000421815.1.93365 WP_000421815.1.93376 WP_000421815.1.93410 WP_000421815.1.93524 WP_000421815.1.93543 WP_000421815.1.93577 WP_000421815.1.93604 WP_000421815.1.93648 WP_000421815.1.93650 WP_000421815.1.93656 WP_000421815.1.93662 WP_000421815.1.93671 WP_000421815.1.937 WP_000421815.1.93767 WP_000421815.1.93804 WP_000421815.1.93837 WP_000421815.1.9389 WP_000421815.1.93937 WP_000421815.1.93956 WP_000421815.1.93986 WP_000421815.1.93994 WP_000421815.1.94064 WP_000421815.1.94070 WP_000421815.1.94072 WP_000421815.1.94132 WP_000421815.1.94162 WP_000421815.1.94167 WP_000421815.1.94168 WP_000421815.1.94181 WP_000421815.1.94198 WP_000421815.1.9432 WP_000421815.1.94354 WP_000421815.1.94379 WP_000421815.1.94380 WP_000421815.1.94383 WP_000421815.1.94458 WP_000421815.1.94473 WP_000421815.1.94557 WP_000421815.1.94562 WP_000421815.1.94565 WP_000421815.1.94584 WP_000421815.1.94588 WP_000421815.1.94598 WP_000421815.1.94622 WP_000421815.1.9463 WP_000421815.1.94649 WP_000421815.1.94655 WP_000421815.1.94669 WP_000421815.1.94674 WP_000421815.1.94717 WP_000421815.1.94722 WP_000421815.1.94785 WP_000421815.1.94796 WP_000421815.1.9481 WP_000421815.1.94835 WP_000421815.1.94849 WP_000421815.1.94947 WP_000421815.1.94959 WP_000421815.1.94967 WP_000421815.1.94971 WP_000421815.1.94983 WP_000421815.1.94986 WP_000421815.1.9503 WP_000421815.1.95051 WP_000421815.1.95085 WP_000421815.1.95094 WP_000421815.1.95121 WP_000421815.1.95136 WP_000421815.1.95152 WP_000421815.1.95171 WP_000421815.1.95235 WP_000421815.1.95248 WP_000421815.1.9527 WP_000421815.1.95277 WP_000421815.1.95282 WP_000421815.1.9530 WP_000421815.1.95388 WP_000421815.1.95404 WP_000421815.1.95456 WP_000421815.1.95465 WP_000421815.1.95546 WP_000421815.1.95558 WP_000421815.1.95607 WP_000421815.1.95623 WP_000421815.1.95630 WP_000421815.1.95641 WP_000421815.1.95670 WP_000421815.1.95691 WP_000421815.1.95701 WP_000421815.1.95703 WP_000421815.1.95729 WP_000421815.1.9574 WP_000421815.1.95803 WP_000421815.1.95805 WP_000421815.1.95826 WP_000421815.1.95840 WP_000421815.1.9586 WP_000421815.1.95866 WP_000421815.1.95901 WP_000421815.1.95911 WP_000421815.1.95939 WP_000421815.1.95940 WP_000421815.1.96004 WP_000421815.1.96042 WP_000421815.1.96045 WP_000421815.1.9609 WP_000421815.1.96107 WP_000421815.1.96139 WP_000421815.1.96162 WP_000421815.1.96172 WP_000421815.1.96190 WP_000421815.1.96206 WP_000421815.1.96260 WP_000421815.1.96317 WP_000421815.1.96335 WP_000421815.1.96340 WP_000421815.1.96343 WP_000421815.1.96404 WP_000421815.1.96429 WP_000421815.1.9644 WP_000421815.1.96469 WP_000421815.1.96490 WP_000421815.1.96497 WP_000421815.1.96500 WP_000421815.1.96521 WP_000421815.1.96533 WP_000421815.1.96537 WP_000421815.1.96555 WP_000421815.1.96563 WP_000421815.1.96584 WP_000421815.1.96588 WP_000421815.1.96590 WP_000421815.1.96600 WP_000421815.1.96640 WP_000421815.1.96642 WP_000421815.1.96732 WP_000421815.1.96735 WP_000421815.1.9674 WP_000421815.1.96758 WP_000421815.1.96761 WP_000421815.1.96771 WP_000421815.1.96810 WP_000421815.1.9686 WP_000421815.1.96876 WP_000421815.1.96890 WP_000421815.1.96902 WP_000421815.1.96917 WP_000421815.1.96993 WP_000421815.1.97005 WP_000421815.1.97015 WP_000421815.1.97047 WP_000421815.1.97089 WP_000421815.1.97143 WP_000421815.1.97145 WP_000421815.1.97190 WP_000421815.1.97224 WP_000421815.1.97297 WP_000421815.1.97318 WP_000421815.1.97322 WP_000421815.1.97337 WP_000421815.1.97368 WP_000421815.1.97386 WP_000421815.1.97413 WP_000421815.1.97477 WP_000421815.1.97487 WP_000421815.1.97496 WP_000421815.1.97534 WP_000421815.1.97594 WP_000421815.1.97597 WP_000421815.1.97613 WP_000421815.1.97620 WP_000421815.1.97628 WP_000421815.1.97631 WP_000421815.1.97640 WP_000421815.1.97691 WP_000421815.1.97693 WP_000421815.1.97704 WP_000421815.1.97725 WP_000421815.1.97726 WP_000421815.1.97727 WP_000421815.1.97732 WP_000421815.1.97736 WP_000421815.1.9775 WP_000421815.1.97768 WP_000421815.1.97772 WP_000421815.1.97846 WP_000421815.1.97873 WP_000421815.1.97981 WP_000421815.1.97983 WP_000421815.1.9799 WP_000421815.1.98006 WP_000421815.1.98019 WP_000421815.1.98022 WP_000421815.1.98107 WP_000421815.1.9811 WP_000421815.1.98110 WP_000421815.1.98124 WP_000421815.1.98146 WP_000421815.1.98170 WP_000421815.1.98201 WP_000421815.1.98219 WP_000421815.1.98236 WP_000421815.1.98250 WP_000421815.1.9826 WP_000421815.1.98314 WP_000421815.1.98403 WP_000421815.1.9841 WP_000421815.1.98438 WP_000421815.1.98440 WP_000421815.1.98446 WP_000421815.1.98483 WP_000421815.1.98495 WP_000421815.1.98531 WP_000421815.1.98570 WP_000421815.1.98577 WP_000421815.1.98608 WP_000421815.1.98627 WP_000421815.1.9863 WP_000421815.1.98676 WP_000421815.1.98751 WP_000421815.1.98760 WP_000421815.1.98779 WP_000421815.1.98843 WP_000421815.1.9887 WP_000421815.1.98899 WP_000421815.1.9898 WP_000421815.1.99072 WP_000421815.1.99083 WP_000421815.1.99097 WP_000421815.1.99098 WP_000421815.1.99107 WP_000421815.1.99184 WP_000421815.1.9919 WP_000421815.1.99197 WP_000421815.1.99215 WP_000421815.1.99219 WP_000421815.1.99255 WP_000421815.1.99267 WP_000421815.1.99276 WP_000421815.1.99278 WP_000421815.1.99327 WP_000421815.1.99339 WP_000421815.1.99456 WP_000421815.1.99493 WP_000421815.1.9954 WP_000421815.1.99561 WP_000421815.1.99577 WP_000421815.1.99626 WP_000421815.1.99637 WP_000421815.1.99646 WP_000421815.1.99657 WP_000421815.1.99660 WP_000421815.1.99712 WP_000421815.1.99747 WP_000421815.1.99783 WP_000421815.1.99813 WP_000421815.1.99858 WP_000421815.1.99889 WP_000421815.1.99924 WP_000421815.1.99958 gi|525838025|ref|YP_008254969.1| gi|537436913|ref|YP_008481290.1| gi|194450244|ref|YP_002045875.1| gi|482903640|ref|YP_007902200.1| gi|378699705|ref|YP_005181662.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]