SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPA00000015839 from Pythium aphanidermatum DAOM BR444 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPA00000015839
Domain Number 1 Region: 3-204
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.55e-44
Family G proteins 0.0000104
Further Details:      
 
Domain Number 2 Region: 189-318
Classification Level Classification E-value
Superfamily Translation proteins 6.48e-23
Family Elongation factors 0.00019
Further Details:      
 
Domain Number 3 Region: 283-387
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 5.14e-22
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EPrPA00000015839
Sequence length 391
Comment pep:novel supercontig:GCA_000387445.2:pag1_scaffold_75:38208:39839:1 gene:maker-pag1_scaffold_75-snap-gene-0.20 transcript:EPrPAT00000015839 description:"Elongation factor."
Sequence
MAEQKQHLSLVVCGHVDAGKSTTTGHLIFKLGGIGEREMAKLQAEADAKGKSSFAFAYYM
DTCKEERERGVTIQCNTKEFFTPNYHYTIVDAPGHKDYIKNMITGSGCADAGLILVPAEK
GGFEAAIAKADPKLGVDEGQTRQHARLLFLLGIEQIIANLNKDTTVEGFTILDALDKLIK
PPVRNPEGPLRLPVSNIYNIKGVGQIICGRVEQGTVRPGDIVGFAPSGLRGKKVFQIEQH
HKQLAAAGPGENVGMSIKGISKDEKVEVGDVIYLEKEGILKPVKSFTAMVFVQEHPGVLK
RGYCPVIFSRTARVACRMTDIKWKMSKKTGNVKVEKPDELSQFEQAEVVFEPTSLLYLDT
FDNCQGLARIAVMDSNRLKMLGKVVGVEYKD
Download sequence
Identical sequences EPrPA00000015839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]