SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPA00000018462 from Pythium aphanidermatum DAOM BR444 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPA00000018462
Domain Number 1 Region: 8-208
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.2e-26
Family Nitrogenase iron protein-like 0.027
Further Details:      
 
Domain Number 2 Region: 403-636
Classification Level Classification E-value
Superfamily HAD-like 6.28e-23
Family beta-Phosphoglucomutase-like 0.028
Further Details:      
 
Domain Number 3 Region: 251-333
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.0000706
Family HPr kinase/phoshatase HprK N-terminal domain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPrPA00000018462
Sequence length 658
Comment pep:novel supercontig:GCA_000387445.2:pag1_scaffold_201:14790:17035:-1 gene:maker-pag1_scaffold_201-fgenesh-gene-0.8 transcript:EPrPAT00000018462 description:"Haloacid dehalogenase-like hydrolase."
Sequence
MGRAKKAAVYVAATRQHVGKTSTCIGLLHGLTSRIENIGFLKPVGQESVLVEGAQLRVDK
DVAVAKVIPPGYTREFLDGKITLESQLTKIRQSFERITSKNDYTIVEGTGHTGVGSIVDI
NNARVAAELGIDMILIANGGIGSAFDDLALNYSMCKEYGVKVRGVILNKVRRDKLDMMWE
YFPKALRQWDIPLIGVVPSLPELANCSMLDFEGLFKTRMLAGTERRFLQYNKTSLVTSGL
RRFLVKLSSNMYNDTLFVTHASRNDIILGFLSHGQNYEARTGKPFNGGLILTGVPPVDQP
QDYIMDIIRSSNLPVLYAPVTTFEAMEMITRFTADAATAKFNPTDRQKVMRCGEHYAKYI
DFDVVLDRGLNANSSEGHEKMPKPMTTPLPVALDTTTTRPLHVKGVTFDLDDTLWCGASV
IRRASAAFHAFIAQRSPVLAAAFPPPQFYALMGRFQRELPHRAHDYTFLRKHVLRHCVSE
VGGPAAALALEQAAAEDEHLEAFVEEAFQAFLITRSEPEFFDGVETLLDDLRADLVRERE
PATPVLGVITNGNCAFDRLPDFFRRHMDFTISAEGVGEPKPAVRIFDAAVACFPESLQRS
EIVHVGDHYEADVVGAKTAGLRTIWIDASRSKPDALSRDMMDAEDATKYPEADAIVAH
Download sequence
Identical sequences EPrPA00000018462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]