SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPA00000021471 from Pythium aphanidermatum DAOM BR444 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPA00000021471
Domain Number 1 Region: 105-350
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.82e-59
Family RecA protein-like (ATPase-domain) 0.0000000294
Further Details:      
 
Domain Number 2 Region: 29-89
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00000000000000204
Family DNA repair protein Rad51, N-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPA00000021471
Sequence length 352
Comment pep:novel supercontig:GCA_000387445.2:pag1_scaffold_461:22739:23982:-1 gene:maker-pag1_scaffold_461-snap-gene-0.16 transcript:EPrPAT00000021471 description:"DNA repair protein RAD51."
Sequence
MQRGQYQKEYVEEEAAHEAYEFQGPRLVNELEQAGINATDINKLKEAGMHTVDAVAMATK
KQLVAIKGISEVKADKMLKAAREMVNVGFTTAADVMQSRKDLISLSTGSNALDELLKGGF
ETGSITELFGEFRTGKTQLCHQLCVTCQLPVDRGGGEGKALYIDTEGTFRPQRLVAIAER
YGLDGDSVLDNVAFARAYNSEHQMQLLVQASAMMAESRFALVVVDSATALFRTDFSGRGE
LAARQQELAKFLRALTRMADEFGVAVVITNQVRVANMEETVTMTANPDSGMFAKDPLQPI
GGNIMAHASHTRLRLKKARGENRVMKVVDSPILPEAEAVYSITEQGIMDEIN
Download sequence
Identical sequences EPrPA00000021471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]