SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPA00000013976 from Pythium aphanidermatum DAOM BR444 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPA00000013976
Domain Number 1 Region: 652-743
Classification Level Classification E-value
Superfamily E set domains 0.00000269
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 
Weak hits

Sequence:  EPrPA00000013976
Domain Number - Region: 406-455
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00471
Family TNF receptor-like 0.02
Further Details:      
 
Domain Number - Region: 5-90
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0246
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPA00000013976
Sequence length 2151
Comment pep:novel supercontig:GCA_000387445.2:pag1_scaffold_16:17769:24502:-1 gene:maker-pag1_scaffold_16-snap-gene-0.34 transcript:EPrPAT00000013976 description:"Serine proteinase inhibitor (KU family)."
Sequence
MACPNGTVCEDHNHNGFGGARGGGNFTLCAPGSFQPRAGQRACLVCPVGFFCPDFGMSKP
LLCPAGMVCDTHGLRTPEKPCPSGHYCPRGTKTGDTSDFMSNPEYRINSETQLVSFIDSG
RSWTYIPRIYPAIGSRRIEHPPNETSCDLRVCDEVDTSVLLAERPYSCPVGMYCRRGVTM
QQSIPKNFSTPQKCFKGFFCPRGSSTPEGQGPCPTGHFCPNDVDAIVCPAGQYCPGVGNI
KPRDCYPGTYNPSPKQSNCTLCPSGYVCPQWAMRAPKLCPAGFVCISTGLSAPVLLCPPG
YICDEGTRTLDPADVIPFRPKPCPKGTYCLGGVAHNRTIEWRPNQPEGATAPQECTEGTY
CFEASRSVSGTGTCYSGHYCPPGTTFPIQAPVGSFSGSSGSVASTLCFPGTYTPLKATVK
CEVCPAGHSCPGYGTYIPITCRPCPEGTWSPHSGLTDISFCEICPAGRVCGSSGMSSLSS
SLPCASGYVCGEGTNRRAQFDHLCPGGYYCGTATTIDRQYEKECQKGNYCVRGTKEAERN
KNKCPEGKFCPVGTANMSSIYIQCPSQTWSIGGQDELMDCSIRTVPVCDKRSTKQYYPQF
KYHFQGSDIPFDSTVEHDRTGEVEVVNIVYPVNESASVPFWKNDTIDAIRTCPPKGSRAG
GLLITVIGRNFLNTSRLVCSFQLPSGGHFLTSPAFYVNSTRVTCRTPPYTSSDGDANDFT
AEINVRVSNYGLRYSETTATFTYISDKAMKTYNTKNQLQKCLLAIGDEEKPRPDDNAWFS
LRGLSKATFSMDFRHIPADLVYDEHYKVALFVKNSTCEYPSCDARKVIKPSGTESETVPC
KLPVELPRWYMSTDVDKHDVLNLTVLALEDVLVKVEVHITYGIYSSVAPFFVNSTTVQIK
TPVRSNVTQGLDADTRPLSDAVSYDAELVVRDYTFLVLYFGGDGDYTSPPLNLPPKYSAF
ERGRVLVSHNVSADSAQIPLITDPIEEVKPNSAYWLMPYGSAALTHQMIEKYRETFHEMH
VDPTDETQTQYIFKFEKVLLSYLPFFSNCKEYDSYIPIFDIFESEKCQLPEMTNELGSHG
RNWWRRAFPPLPNQDDIRHVGPLDVGGEPVADLCMVDVQCHYEEDLPTADVTPRWFEQSK
DTVLYYILREPATLANYFRGGAYVDDLMDELGSDYFIPVTVDNDAAKEVEGDCSTLCFPR
KVTLDVAYYQIDDRTKRIIKAQLIYEEYDRDATNSKYTLSVNYHALSYFQLIIQFAFEKQ
VFVFLFMVLGSMIMVGAFVFWGVVRLTTFLESPPRLRFWSVFALIAPPPSVGVVLACAPI
FAVVCCFYVLLKGDKYFSARSASGYWLMDNIVKHYMVDKINPDEVDATRKGRLGFCFLAL
GLYLIFLGAKIFLPKSISIAEKIMHEKNDQEAIERNVWWPTQWKRANMVFTSILLGLFLV
LMLEISFWSSFGDYMFYVIVITEFVNAQVEGWIEGQLKESLLMSPLVSALSLIGGLMTFG
ATDFGDFVMGNTLDFGMMLLQRVYVDTAFEAAGEFIELITSYVWEKLKKVGKAFLVLFRS
FTRSTTSNETEGEKKDEKKEEEKKEDEEGGGETVEPIIDFYAGCSMDRLAMFYQPVLILI
MMFFRDEVQLPILYNIREKDMEIYLWYSLIILVFQLVCEVFVLNVVELFQGWKLYDYLVY
CRYRFMQREQRWKGMEPNLDECIDENLRTLDQMCFSSQFFMMCTIHITGIVFFCMAIEIM
ARAGYNLFGDPAMPILAAFVICVSVFVHRFVFWLAMKVEFWKIKHENTAWLAPPDDDDEF
GVPRWEDLEKIKGASHEAYLMNQRITSETFRFKFLNYNRSWIVNQLPSILTPRTLRRARP
YLLAQFAKILDSLNPAISDDGEDDDDGRPKFGPVTLSASSRTIIRLWLARARRIQRLKSV
VQPIIQQARKSECEMCLSRRQLQVELAIPIEVLGDKFEAQSLAEEFDVAGWKEFFSKHEK
FKTICLNCIVHLRETQGNNTRALFGFRGGDGADGYGGPGGDWGDVQLNAASYALMQKWYR
RAQDRVFGKHGKRRNMVDVSDDEEEVMARHFEWTKRPVVLNAASTALARKWLMGARQSLR
ESGRLNTRIPENLTAVPMSVRAGTATPVPKPAMKMGAAGGDGTKTSKMRRK
Download sequence
Identical sequences EPrPA00000013976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]