SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPA00000018096 from Pythium aphanidermatum DAOM BR444 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPA00000018096
Domain Number 1 Region: 631-712
Classification Level Classification E-value
Superfamily E set domains 0.000000317
Family E-set domains of sugar-utilizing enzymes 0.075
Further Details:      
 
Weak hits

Sequence:  EPrPA00000018096
Domain Number - Region: 6-79
Classification Level Classification E-value
Superfamily E set domains 0.00051
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.061
Further Details:      
 
Domain Number - Region: 1832-1887
Classification Level Classification E-value
Superfamily E set domains 0.00084
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.036
Further Details:      
 
Domain Number - Region: 486-527,567-589
Classification Level Classification E-value
Superfamily E set domains 0.0191
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.032
Further Details:      
 
Domain Number - Region: 1066-1140
Classification Level Classification E-value
Superfamily E set domains 0.044
Family E-set domains of sugar-utilizing enzymes 0.05
Further Details:      
 
Domain Number - Region: 1211-1304
Classification Level Classification E-value
Superfamily E set domains 0.052
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPA00000018096
Sequence length 2361
Comment pep:novel supercontig:GCA_000387445.2:pag1_scaffold_180:2424:9540:1 gene:maker-pag1_scaffold_180-snap-gene-0.7 transcript:EPrPAT00000018096 description:"Conserved gene of unknown function."
Sequence
MSGLRIRLLEPSVGTSAGGTRVVIHGRGFRPVPHSLLVRFRLPETGARVEVQGRFLLETQ
LECVVPSFQDDVRSVLARHTNLAATSSTVALAPDLVVLHVEVIVDSDRVSNVLSFILHQE
LAITKIAPQFVLMTPPTVITVTLNLLKLSSAVRLFPPRDSHLAPAPRDLAEISSLPVYVR
VRQTSERTGAVSERTVEGRWKVSPVGVFEIEFDAQMMTFGDAVVDLTLNRIEYYRVKDKL
PDARGYNVHRDFALLSVDPSCCDKRPFRRKFGSLEKASLTPHDIQSAASKAVRANDRLHE
IANLTATFVSVTEVRCSVQANMPFGLTFFQLSLNGGRQFGKDSAVGLLYRDREAEAITPE
YASIEGNTLATIRVARLSIDDVDALSQLQTLVPPRRVRVRFRTISDGTSSEEMVKVVNAE
VPNPDEPYIVRCRVPSFVGSVQIRQQSDCSGDANNTDVGVKRLLVSLSLTGDKYFGALPF
GLFHPPVIQSITRHHGPCSGGTLVILRMKHRVPPELPIQVRFLSLTTCQLKTVSGTVGVK
SANPLHPLPASGSPSRHRQMPSDDPAYLIVCTTPPWDTDVPVLTKVQVSFDGGFNFVPLE
DGTERSLMSPRSRRIPSQLEKDMSYLYFLFYPIPRISSVNPMSADIQGGSFIRIGGENIV
DHGGEISVVFQSQNFSRKVTGIVDHGEIRCCVPPFNVGTAAVFVTLNGDQYTKCDFIDPD
TKRPFDFVFYSSPLLQRLSPLCACISQSSLIRLFGVNLIETGRVKVRFGFTNHQGKLVYK
DVPARGHDGIIMVQSPLFGPDYGNTNAVVDIALNGNDFSGRTLALYFYSSYAIKCVYPEV
GAFDIPIMVTLVLAQNIVSDSVIVRVRFRNRHQQNETMFGPTPVSRWETNRVEVTLPAIV
NLLPSVDVLEAAFVDLSFDKVYFHNVGDLLPHYRVYQLPPMFSVSPLVGHFEHDTTVVAK
CSNLIESEKVVIKLILDVSECLGLDRIGPQTMAITVETETNAKRQTLTWRVPSLRAFVGD
RFNPAQLLLNTKGMMLPIKVKMEISTVPDQLKPLPFEFCFYRIPDLVSMAPQVGYVCGGS
IVSFEFKQPIETPTVDFRFGSDLITSGRIRDDNKCLVECLTPALATGVHAVAMSFDEQYF
ETAHIDVEDLDEELEDVGICISEDATRHTILEEPGMIRPAKDGATRLGCRKAVFQTYPMP
YFVIPENQHRVYSFGSTDGGSHVIIKGHGFIPEGKIYARFVSPMPDVFSTQDGLQSMIII
KAKVLNASTIQCVSPVTTKSGRVRLEITYNLQEFTDSRCCFEYHDPTTFVSRGTLCGPVS
GGTPVCLKVENRQGLPEDLSLVKSSCALRFKSDKSGYYEDVQATFDEQELTIQCLAPPWP
SNELVAVEASLARDVILSPAPTLFVQTGVRFLFYDPPEGLITIEPAAGPTSGGTEVLAWC
GTIVDTGEIMVSVTMVTENMAGGGKLGSLGEYDCDEDGDGSDDEYELLEAEERTKEPKVE
PDVYLVKGKIVGEAVSFVTPAVKSAGTAYLNIALNGINYTSSRTAILQFKYYFEPVIRLI
TPSWCSVDVPSLVTISGDNIENHGCSAVVCFELQRSGQPEEDDLPSDCTRVEGSFVEVVR
QSSKGSTVPSKSEPVVQCLFHAPRSGYFEIQISLNGGQQFSAAKYMLATYANYSGSACTA
LLPFRSFSSPFFLATPTGSVAGGSTVMLFLSAKLSKMLSRDVAKCQVLFTPTKGSTSVSG
PTSSLKASSHSADAVTVTGEINHAEASITCRAPLLRSNCSATLDVLLLASALSSSDGTSV
IPVTPRHNGALVSCASLFNVKEREVFFAYESPTITELKPTCGPLSGGTFVVIECANIIDT
GQIFVRFRSSSNERECVLVPATFSRKYPDGSLSAFPLLICRTPRVEVIDRFLIVANDAGH
PSPTSSGRVSSSRDNAAAAISSKARAHSFQQMAEQSLKRDQPNVLRVTRTVLKNAAVANA
AISVLIDFTMNAGEQFIAHSVPYYYYPDLSPQELNWFPRHVPTQCMDRGTPTDTRIVTVQ
LPKTLRSFAESPAAAERAAFYFEGAPQQLFSSSQKRRGSSLVLHETGAARELLVLDAGPV
AKLRSQSTMRRRSTYVRNTSISASSNNLLDSSGSSFVSSPPRQRARRPSGTTGGARRPSD
ATGLGGNSALPGPTAPSSSAHSSHGNSPYIAARIVKGELLLVCPVPDFSCAGSVRVFLSF
NAQQFICLGELRIHDPLSLRENRHHRFTSNIGGDRFVLYCSPSTMFEYLRRDDILSEDEL
LERQRRETGVMQLSRLRTEPSVSAEASDVPQRQIEFDQWHDRLFYVVRLRLVPPNPRAMR
RIMVSACSFDSKTELSTSSLE
Download sequence
Identical sequences EPrPA00000018096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]