SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPA00000018108 from Pythium aphanidermatum DAOM BR444 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPA00000018108
Domain Number 1 Region: 966-1101
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.83e-17
Family Synaptotagmin-like (S variant) 0.042
Further Details:      
 
Domain Number 2 Region: 1204-1287
Classification Level Classification E-value
Superfamily E set domains 0.000000204
Family E-set domains of sugar-utilizing enzymes 0.085
Further Details:      
 
Weak hits

Sequence:  EPrPA00000018108
Domain Number - Region: 1387-1468
Classification Level Classification E-value
Superfamily E set domains 0.0098
Family E-set domains of sugar-utilizing enzymes 0.031
Further Details:      
 
Domain Number - Region: 601-655
Classification Level Classification E-value
Superfamily E set domains 0.0182
Family E-set domains of sugar-utilizing enzymes 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EPrPA00000018108
Sequence length 1597
Comment pep:novel supercontig:GCA_000387445.2:pag1_scaffold_180:9584:14377:1 gene:maker-pag1_scaffold_180-snap-gene-0.8 transcript:EPrPAT00000018108 description:"Conserved gene of unknown function."
Sequence
MFLTAVTTASGSSLQPTSVVSMAALSTFSCVIPESRFHRTTASTDRAPDTTGVMVQLPSA
DSDLAACIYCECGSPFPFLFLTETGKPVEGCVRIMADESGVGQWVLASLNMSEWIGYPKS
STSESVLHFFICCDLREQSDERYEQHVVIANRSGAALYLLAPKPSIVRGIWIVASVYTAH
GAVSIAQIDRVIDDPTSIASDESFANYYRQAIYDGVSCRTVVDEAKGSASVSVAVQFACA
DSSRNLSSTAPGQIILPTGHTPSSVLDDAAEVEILCEMPPLAFNGPTIVSILVDGVLFSN
SLCMHCYDPRLWRITRLDPPCGLVGMSFRARVLGEHFVDNKKTVVRFSDNSRFINYAGSL
ERYHLVVVRIGSVRNLRMLLPPRYSSSFQSNPANSNGSPSKLQQLQSREDNNTAGSIPSF
TVGVRVLYQDQCFRSTSRESAVLAALVPLSTTPLSWEDQFEVLVAKAAVATGELVATLEL
EELTMPASTRSIHEIGRVVVPFRELTEAVLVKQTFAVEQHFMWGGGLPNAVATSPSELDV
FLHMSPLMTRTDVVVCDVAPFLVPQRFRVQISSGDSLFSPCPPDWNESTDASSTSSFRAY
ELPVVTDTSPRVLPRSAGGEIMISGRGFIYCGTNDAIVVRIFGVASSHSSSSSTQSDLLA
SINNISSLRAKPESVLFIRDLKATFISSEALRVTIPSLLATYVLYYRVSMDDGVAFTTAS
ESSRVMLYSADSVEPKGGPVSGNTYVALHGTNINGCMSLGGLIPVVRLTWMRGVKELEAV
VVRAEFYAPEDIVYFYTPQSKFGLRNITVHVELSLVESEMIVATGDIEATNLNIPAARFG
QDEIPFVIYRSPAVKALAPLNGLVYGLSIVDLVVQGLDDKTSGLLKNSLKARFKRRGQMQ
IADVQVAAGTSAKDGRLVTSVPRFNVGSAVATEIAVASSPVRGIVSNFSNASRRGPLKVW
NRHSAIYVVLLRARNLFVAKRTATCNPFVVINCDKMQLRSTRKDATSSPVWNELFDFDWR
NDKELPRLIRFSVENQLSAGQSELLGQVHIGFSDHTKVLKPFSLRAWFPLQPVSARGSGG
DTTGGNRTELGELEVVIAFIPVPVKKAPPTKIFQTAALKSTILTAMQQKKKAAQQAEQTQ
CHQTLSTDHQQAKAATRSRKEHLLRAFRRQGAPPSLVPTELIVELALNGQDFWSVAPSRC
LLLPTPIIVSVEPRFICLSGGTPVTITGMNFAQTSALRVAFAVISESSPQVVDGKRVAIV
DAQYRSNHCITCITPSLEPVRASEVSVIALFVTINGVDFDSVALPAHSLLSLPLSPETRA
ASSQLKDATQTQPSSPVFKVEGRNYVVNPVGVSGDQMGAGAAVNSECDSTSVVPSNWLAC
HVRVYNRPIIERVRAADGIYTSQLVIEGSSFSNTSHVVAKYCSTSDARDVRTSAVRVVSS
KRMECSMPDFPRGTLVTISVALNGVEFFSCPGEYAVFQLPRLTRVVPNWISVRSSQRQDV
RLLGVNLTANASASGSVHVSFIRGDRRLVVKGQCVDGEVLCSVPRELIAWGPHGDGNNTP
PVLTPSIWVDVWLGGSHKTVRTSIEGQWLGVLTLTNA
Download sequence
Identical sequences EPrPA00000018108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]