SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPA00000021589 from Pythium aphanidermatum DAOM BR444 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPA00000021589
Domain Number 1 Region: 189-322
Classification Level Classification E-value
Superfamily E set domains 0.000000007
Family Arrestin/Vps26-like 0.012
Further Details:      
 
Weak hits

Sequence:  EPrPA00000021589
Domain Number - Region: 25-167
Classification Level Classification E-value
Superfamily E set domains 0.00091
Family Arrestin/Vps26-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPA00000021589
Sequence length 389
Comment pep:novel supercontig:GCA_000387445.2:pag1_scaffold_476:903:2182:-1 gene:maker-pag1_scaffold_476-snap-gene-0.12 transcript:EPrPAT00000021589 description:"Arrestin domain protein."
Sequence
MDYRDPSIVRSARLFGGELGVKGLLRIVVDRPVYRAGDLVTGRIFVTVREPIRSDTNGGG
AAAALSCSIVGEEIAQWMQSGDHHSQYHEFLKHEIMTSVLPDPYMPGEYMYPFEYLLSED
LPGVLDADGLFGSVDSLHATIKYTLKARIRVEGRFVTDLEAQFSLIVRARERLPTRTSAV
ERTISKKIRALNMVNRGTCHVAAAMPKNIFMIGETARVDCFINNHTSSVGVRQVKCRLYQ
DVTLKLPSGVTRKCTRLLSQVKCPGPRSGDLLERPMQLAIAGKVRYPTTVGHFLSCEYRI
GIECDLLWRTGLSVDFPIIIVAGDAGHPDMTMQSLSPPSSGARPSMAHQHHGLQGPASMH
QRPPSVAYQHQHPSMAYRPSQDPHRASFA
Download sequence
Identical sequences EPrPA00000021589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]