SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22297568|ref|NP_680815.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22297568|ref|NP_680815.1|
Domain Number 1 Region: 30-146
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 5.63e-28
Family Pentapeptide repeats 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22297568|ref|NP_680815.1|
Sequence length 214
Comment hypothetical protein tll0024 [Thermosynechococcus elongatus BP-1]
Sequence
MTNPQHLQLLKQGVTAWNQWREQNSDIRPDLGQADLTGANLELYNLTNANLDQANLAGAD
LRNALLKDAYMAGANLYMSDLIEADLQGACLQRATLVGADLYKSNIAMADLRQANLVGAL
LRRVSLVEATLAYANLTRANLFQANLYLADLKGAILQEAILESASLIEANFESAVLIAAK
MAKANARRANFKGANLYKAEMDDMDLRNAILDKA
Download sequence
Identical sequences Q8DMT7
NP_680815.1.97157 gi|22297568|ref|NP_680815.1| 197221.tll0024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]