SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22297594|ref|NP_680841.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22297594|ref|NP_680841.1|
Domain Number 1 Region: 30-316
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.62e-77
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000218
Further Details:      
 
Domain Number 2 Region: 304-406
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 3.01e-16
Family Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22297594|ref|NP_680841.1|
Sequence length 408
Comment tyrosyl-tRNA synthetase [Thermosynechococcus elongatus BP-1]
Sequence
MSSDLEATIARLQRGVVETFPHVPDSVKPEENLWAYLRQTQRPLRIKFGIDPTGSEIHLG
HSIVLRKLRQFQDAGHCAVLIIGDFTAQIGDPTGKSEVRKQLTPEEVAANVQTYLEQVRP
ILDFETPGRLEIRYNSEWLAKLDLRKVLELLGTMTVGQMLAKEGFAERYAKETPIFLHEF
LYPLMQGYDSVAVAADVELGGTDQKFNIAVGRDLQRHFRLPTVQFGLLMPILVGTDGVQK
MSKSLGNYVALTESAASMYSKLEKIPDALVNQYIELLTDLPLDSLPTHPRDRQKALALAV
VSQYHGQELALQTQAELAAIVTQGQTAQAGSIPEYSLGEFQFPVKLTYVLSHTKLCPSSS
EARRQIQGGGVRLNGEKITDVDFTLTAPEPYVNQVLQVGKKKFLRFVP
Download sequence
Identical sequences Q8DMR1
197221.tlr0050 gi|22297594|ref|NP_680841.1| NP_680841.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]