SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22297637|ref|NP_680884.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22297637|ref|NP_680884.1|
Domain Number 1 Region: 4-179
Classification Level Classification E-value
Superfamily RL5-like 7.53e-77
Family Ribosomal protein L5 0.000000348
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22297637|ref|NP_680884.1|
Sequence length 181
Comment 50S ribosomal protein L5 [Thermosynechococcus elongatus BP-1]
Sequence
MSQRLKDHYNKTVVPQLMQQFQYKNIHQVPKIVKVTVNRGLGEAAQNAKALEATLAEIAT
ITGQKPVVTRAKKAIAGFKIRKGMPVGVAVTLRSERMYAFLDRLINLALPRIRDFRGVNP
KSFDGRGNYTLGLREQLIFPEVNYDDIDQIRGMDVSIITTANTDEEGRALLKAMGMPFRE
N
Download sequence
Identical sequences Q8DMM0
NP_680884.1.97157 197221.tlr0093 gi|22297637|ref|NP_680884.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]