SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22297654|ref|NP_680901.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22297654|ref|NP_680901.1|
Domain Number 1 Region: 3-67
Classification Level Classification E-value
Superfamily L28p-like 3.65e-24
Family Ribosomal protein L31p 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22297654|ref|NP_680901.1|
Sequence length 91
Comment 50S ribosomal protein L31 [Thermosynechococcus elongatus BP-1]
Sequence
MPKPNIHPQWYPEAKVYCDGEVIMTVGSTKPELHVDIWSGNHPFFTGTQKIVDAEGRVER
FRRKYSGTKPQQTAKGKKAAPKSTPKTNKKG
Download sequence
Identical sequences Q8DMK6
197221.tsr0110 gi|22297654|ref|NP_680901.1| NP_680901.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]