SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22297741|ref|NP_680988.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22297741|ref|NP_680988.1|
Domain Number 1 Region: 1-31
Classification Level Classification E-value
Superfamily Subunit XII of photosystem I reaction centre, PsaM 0.0000000000381
Family Subunit XII of photosystem I reaction centre, PsaM 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22297741|ref|NP_680988.1|
Sequence length 31
Comment photosystem I reaction center subunit XII [Thermosynechococcus elongatus BP-1]
Sequence
MALTDTQVYVALVIALLPAVLAFRLSTELYK
Download sequence
Identical sequences P0A403 P0A404 V5V2H8
1jb0M 000004742|e1jb0M1|5022.1.1.1|M:1-31 000142280|e3pcqM1|5022.1.1.1|M:1-31 000151859|e4fe1M1|5022.1.1.1|M:1-31 d1jb0m_ 1jb0_M 3pcq_M 4fe1_M 5zf0_M1 5zf0_M2 5zf0_M3 5zf0_M4 5zf0_M5 5zf0_M6 gi|571026983|ref|YP_008899101.1| gi|22297741|ref|NP_680988.1| NP_680988.1.97157 WP_011056052.1.87165 197221.tsr0197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]